SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TTB3|A7TTB3_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TTB3|A7TTB3_VANPO
Domain Number 1 Region: 147-259
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000000000222
Family Reverse transcriptase 0.0063
Further Details:      
 
Weak hits

Sequence:  tr|A7TTB3|A7TTB3_VANPO
Domain Number - Region: 12-106
Classification Level Classification E-value
Superfamily Acid proteases 0.000242
Family Retroviral protease (retropepsin) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TTB3|A7TTB3_VANPO
Sequence length 262
Comment Tkp3 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_250p4
Sequence
MRGIPKEKNLIVLDTGADANFTYSYLWKNNDHIQFKNLSISKGSTRTCPSLTATPAFGVS
LIITTQIYLTIQIGNAKITEWFYVIPQKRSHIILGKPLLKKLHYHLSPKDESLTIQDTTI
DVTHFPGISATNTLLKIEKIPFLTQLKHEFAEVFSSNFSMDLKHKFTAHISLINFPYTTP
KAYFASGLRREAIRKYVDQSLENGLIKPLSPEEVVAVSPVFALQQSSEKIRIITDLRKVN
KYLQFTPRPIPTSSDSYYTIHS
Download sequence
Identical sequences A7TTB3
XP_001642353.1.22633 tr|A7TTB3|A7TTB3_VANPO 436907.A7TTB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]