SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TTK5|A7TTK5_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TTK5|A7TTK5_VANPO
Domain Number 1 Region: 122-312,342-467
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-18
Family Reverse transcriptase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TTK5|A7TTK5_VANPO
Sequence length 479
Comment Tkp5 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_377p1
Sequence
MSPSPIESPGLSTDSFSIVSRGDLTSSSDSPLVPPSTNGSPLNFALFAVWLASSISQKTS
KAPTTIKQALYGPDGAEWRAACLKELSAFKEHQTFSLVPPPSDGRSLGTRWVFTIKDDGR
KKARLVAQGFRQKEGIDYTETFAPVIRYDSVRVFLALACCLNLRIHQMDVNTAFLNSDME
ESVYVKQPPGFIDSDPAHEGWVWKLHGGMYGFKQAPLLWNKHINRSLTALGFTRNEKEFG
LYFKQTADGPLFVALYVDDLLIAAPSPRIISLTKKKLQEIYSMKDLGPVSKFLGMNITQF
PNGNITLSLADYIAKAAADQQTPLHKKVHIPLSPTINYFDSNSPAAKNITTYQSIVGQLI
FIANAGRPDIAYAVSLLSRFLKDPRVVHLNAAHRVLQYLYTTRFHGLAYRAGSPLQLTVY
SDASHGSLADMPFSTGGYVTRLAGGCVTWSSKKIKTTVCLSSTEAEYIAASEAVKEIEW
Download sequence
Identical sequences A7TTK5
XP_001642259.1.22633 tr|A7TTK5|A7TTK5_VANPO 436907.A7TTK5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]