SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TTP9|A7TTP9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TTP9|A7TTP9_VANPO
Domain Number 1 Region: 328-434
Classification Level Classification E-value
Superfamily AMPKBI-like 4.45e-31
Family AMPKBI-like 0.00000392
Further Details:      
 
Domain Number 2 Region: 135-216
Classification Level Classification E-value
Superfamily E set domains 3.31e-21
Family AMPK-beta glycogen binding domain-like 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TTP9|A7TTP9_VANPO
Sequence length 435
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_195p2
Sequence
MPDSNIPQKDVSMTDFEDAIASNTNSITQSLSQMNIDGPNELEPQTLTKHKSTLIFDDDD
EIPPYSNHEEHANDLVSDSGDENDSTSHLQNGSHQNSTIVSQPQQQQQQQQNHQPAQQQP
AGQPSSQPQQRNTVMVPVDITWQQGGEKVYVTGSFTGWRKMIGLVPVPGQPGVLHVKLQL
PPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAVAPPQTWTDEQQQQEQPQDLQTQ
QLLNQQQVQHAQQPQVQQPQVKESQVANDNQQDITRPESTTNKKSKKMPTSARSRIAFEI
EQEPDDMGDGFTRFREEKPLKPQLEYTQDIPAVFTDPTVMEQYYLTLDQQQNNHQNLSWL
TPPQLPPHLENVILNSYSSNSPETGQNNSGSLPIPNHVVLNHLATSSIKHNTLCVASIVR
YKRKYVTQILYAPLQ
Download sequence
Identical sequences A7TTP9
436907.A7TTP9 XP_001642216.1.22633 tr|A7TTP9|A7TTP9_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]