SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TTV8|A7TTV8_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TTV8|A7TTV8_VANPO
Domain Number - Region: 5-163
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00222
Family RNA-dependent RNA-polymerase 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TTV8|A7TTV8_VANPO
Sequence length 211
Comment Tkp5 protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_202p1
Sequence
YCYAGRPDIAYAVSLLSRFLKDPRVVHLNAAHRVLQYLYTTRFHGLAYRAGSPLQLTVYS
DASHGSLADMPFSTGGYVTRLAGGCVTWSSKKIKTTVCLSSTEAEYIAASEAVKEIEWLG
DLTTVMDLTLNKTKLYVDNEPAIKLSKNPVMHPRTKHIALRYHKIRHAVEQDIVDLEYVN
TKDQQADILTKILAKSQFETLRDELVSNLTT
Download sequence
Identical sequences A7TTV8
tr|A7TTV8|A7TTV8_VANPO XP_001642157.1.22633 436907.A7TTV8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]