SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TTW6|A7TTW6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TTW6|A7TTW6_VANPO
Domain Number 1 Region: 219-443
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.85e-57
Family Reverse transcriptase 0.00063
Further Details:      
 
Weak hits

Sequence:  tr|A7TTW6|A7TTW6_VANPO
Domain Number - Region: 62-154
Classification Level Classification E-value
Superfamily OmpH-like 0.0366
Family OmpH-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TTW6|A7TTW6_VANPO
Sequence length 457
Comment Tkp3 protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_64p1
Sequence
MEASIKALQESIEALNAKMDERQQEDLAYRAKIQQSFEAMNTMNTDLATKLLELKTKDDE
ERKVLKEASIEFTKFQKEQEEIKKEAKELGVELKEERKHAEAILKMEEQALQAKFEEEDK
NLENLRDGIAEEVPKYLQEFRGEIINQVNNLIAEQDNPTQGKINNNEKLQKEKILLSKIK
KHSSSIIIDEDNQIILECTKRFTDANLTPIDTDEVVALSPVFPIQQSKDKIRIITDLRKV
NTHLLYTPRPIPPIQHIFSNLANKTIFSSLDIRKAYQQIPIQGDKLGLITELGSYKFNRL
PYGLASAPYWWGEFIQNILKQLPQSKDTIVSYYYDDLIIASSTIAEHYTTLKHIMALLAE
NGLSLSYEKIHIAQPKVLFLGYEVSHNRLAIDKEKKNTIARWVLPEDKKAIEKFTGFVNF
LRNFIQNASQILAPFYSFATNKPSNHEKTILQKAMKK
Download sequence
Identical sequences A7TTW6
tr|A7TTW6|A7TTW6_VANPO XP_001642149.1.22633 436907.A7TTW6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]