SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for sp|A7TIJ7|RSSA2_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  sp|A7TIJ7|RSSA2_VANPO
Domain Number 1 Region: 12-190
Classification Level Classification E-value
Superfamily Ribosomal protein S2 1.57e-61
Family Ribosomal protein S2 0.0000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) sp|A7TIJ7|RSSA2_VANPO
Sequence length 251
Comment 40S ribosomal protein S0-B OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RPS0B
Sequence
MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNTRPDGVNVINVGKTWEKIVLA
ARIIAAIPNPEDVCAISSRTYGQRAVLKFSAHTGATPIAGRFTPGSFTNYITRSFKEPRL
IIVTDPRSDFQAIKEASYVNIPVIALTDLDSPSEYVDVAIPCNNRGKHSIGLVWYLLARE
VLRLRGALVDRTQPWAIMPDLYFYRNPEEVEQQAVEEASATGATEEATEEATEETTEATE
WAEDNTENATW
Download sequence
Identical sequences A7TIJ7
436907.A7TIJ7 sp|A7TIJ7|RSSA2_VANPO XP_001645793.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]