SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TDP9|A7TDP9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TDP9|A7TDP9_VANPO
Domain Number 1 Region: 150-354
Classification Level Classification E-value
Superfamily Ribosomal protein S2 1.28e-64
Family Ribosomal protein S2 0.0000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TDP9|A7TDP9_VANPO
Sequence length 375
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1018p50
Sequence
MLERPSEDEDISLMRLKDFNDDIVNRFKALESTPLQDLNLKNSKGHLSPKEKQLDTELAN
FLRKFTKLNNSIDTDDNVNSSSNNVVKPIRGREFPFLEPSASVKPYTEQELFLRQLNHSS
HVAKLGANISNVYFPSNDIHKPVSPQELSIAKLMAAGVHLGQSTALWRASTQPYIYGEYK
GIHIIDLNKTLSHLKRAAKVVEGIAERGGIILFLGTRQGQKRGLEEAAKRTHGYYVSSRW
IPGTLTNPTEISNVWERHEVDFFDTPTGRELTQNEQISIVKPDLLVVLNPTENRNALNEA
MQARVPTIGIIDTDSEPSFVTYPIPGNDDSLRSVNLILGVLAKAGERGLENRLLKAKAAE
NAVESDVTIETEAIA
Download sequence
Identical sequences A7TDP9
436907.A7TDP9 XP_001647377.1.22633 tr|A7TDP9|A7TDP9_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]