SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TDW8|A7TDW8_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TDW8|A7TDW8_VANPO
Domain Number 1 Region: 9-459
Classification Level Classification E-value
Superfamily L-aspartase-like 1.24e-134
Family L-aspartase/fumarase 0.000000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TDW8|A7TDW8_VANPO
Sequence length 460
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1018p125
Sequence
MSSQKLWGGRFTGETDPLMHLYNASLPYDYKMYKADLEGTKVYTQGLEKLGLLTEVELSK
IHDGLDAIKKEWDSDSFVRHPNDEDIHTANERRLGELIGTDISGKVHTGRSRNDQCVTDL
RIYCRDIIQDKLLPSLKSLIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYF
TEDYKRLKQLLDRLNVSPLGAGALAGHPYGIDREFLANGLGFNGVIGNSLVAVSDRDFVV
ELLFWGTLFMNHISRFAEDLIIYSTAEFGFITLSDAYSTGSSLMPQKKNSDSLELLRGKS
GRVFGNLSGLLMSLKGIPSTYNKDMQEDKEPLFDCLTTVEHSILIATGVVSTLNVHKEKM
EKALTMDMLATDLADYLVRKGVPFRTTHHISGECVALAEKLNLSGIDKLTLAQFQEIDPR
FEQDLFETFNFEQSVERRDAIGGTAKKAVLAQLQSLQSQL
Download sequence
Identical sequences A7TDW8
tr|A7TDW8|A7TDW8_VANPO XP_001647446.1.22633 436907.A7TDW8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]