SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TFX1|A7TFX1_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TFX1|A7TFX1_VANPO
Domain Number 1 Region: 20-219,264-642
Classification Level Classification E-value
Superfamily ARM repeat 7.53e-68
Family Clathrin adaptor core protein 0.0000206
Further Details:      
 
Domain Number 2 Region: 765-833
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 0.00000000241
Family gamma-adaptin C-terminal appendage domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TFX1|A7TFX1_VANPO
Sequence length 838
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1023p103
Sequence
MGSSLKSFIKDVRASKTLAEERSIIQKESAKIRTKLRDDHLPLEKRRKNIQKLLYLFILG
EKTHFGQVECINLIASDEFVNKRLGYLAAMLLLDESQDLLTLLTNLLNNDLNHPNKFIVS
LALTTLGFLSTLELARDLYPDVENILKTCKDPFLLKQALQCAAKLIAKDVSLLDIFSMEY
ISSIFENHAICTHSVLLGISKVLQSILLAYPGYLDLLREDGVELNGENHQILNDGIKFIP
ELLSRLQSLNVKSSQPDYDVKGICDPFLQCEIIYTLRLFFLLDVPEIDRFKNKFEDLLSQ
IATDTDGSKTSGQAILYETARTIFSLDLEQPLRILGINILAKFLSGRDNNVKYVALNTLL
RVVPQEPTAVQRHRKFISRCLHDPDISIRMRALELTFAILDENSLVELVNELVKFLESAS
GDDKDLIIFTVDNLVETFEKFKVHDEKWKLDIFLKVLELVGSFITLEKLGDILIIINNTE
DLQNKIYVVSKMLKVSLSNDQDSVIQIFDDNLGWKLVTIWCIGEYADLILLKNASEIINE
ESMTKYLLKLDSEYGTYDSKITQYVLTASLKLSSKIDNRKCIEDLRQIILNHTKDPNLMI
QVKSVQYELIFSQPREIRKSILASMPIFERKVRTPDMDTQSNVHQKSKPVASNADLLLDL
LGDMDSSSGQQQGKAPEMTLSSESTKPENSKPTDLLADIFSSNVNNFNGKAEPVGTSSSL
EFKSTVTLPTNATKIYDGKALIVYSGDVTVENGSANFELYFEAKSSVTDLSCQSAVPKSQ
KLTMGSLYPSASVGHGQLSKQSMKVSGSGKLKLRVKLKYNSEGISNDEQFDHKFNEAL
Download sequence
Identical sequences A7TFX1
436907.A7TFX1 tr|A7TFX1|A7TFX1_VANPO XP_001646787.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]