SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TGG2|A7TGG2_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TGG2|A7TGG2_VANPO
Domain Number 1 Region: 44-256,441-693
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.05e-131
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000039
Further Details:      
 
Domain Number 2 Region: 253-444
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 5.36e-31
Family ValRS/IleRS/LeuRS editing domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TGG2|A7TGG2_VANPO
Sequence length 753
Comment Putative uncharacterized protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1055p89
Sequence
MLIRGLSIGKGPLLRRFYRVSSILQNVKGDNIVSDSNLVNVGKKWENKVRDCVELKNDSS
SKDIYVLSMFPYPSGTLHLGHLRVYVISDVLNRFYKLNGYNVLHPMGWDSFGLPAENAAI
ERRINPADWTIQNISKMKDQMKCMLANFDWDRELSTSSPEYYKFTQWIFLQLFKQGLAYR
KEAEINWDPIDQTVLANEQVDAEGRSWRSGAIVEKKLLKQWFLGITKFEKQLNHDLNSLT
NWPTKVKAMQKHWLGESHGTDIIFKLNGEHLNSVEIFTTRAETIFTVQFLALSLNHEITK
YFSEKDSNLKQFLGKTFLEDSKEGYRINELYAINPITKEKIPVFVAPYVLDTYGHGAVMG
CPAHDERDREFWLTLGNKHIKEPCYGMPLDNADLKSNGNSKSGEMNATTSEFQGMSFKSC
RQEITSKLSTLGLGKTAVKYKLRDWLISRQRYWGTPIPIVHCSDCGPVPVPEDQLPILLP
KVPTLTKKGNPLADVPEFVNTKCPSCGNAAKRETDTMDTFIDSSWYYFRFTDPTNAKLPF
SKENVNRYMPVDLYIGGVEHAILHLLYSRFIAKALGTAGFWDGASVNYEPFKKLITQGMV
HGKTYKDPNNGRFLKPDEIEIVENSKNSVIIKSTGEEPDVSFEKMSKSKYNGIDPTKFIA
KHGPDATRAHILFQAPIENILNWDSQKIVGIERWLNKLINLTNQITALASFDEKFSTPDV
LSGPNAKFHNEFQTLVHSITISFKDNISLNTVF
Download sequence
Identical sequences A7TGG2
tr|A7TGG2|A7TGG2_VANPO 436907.A7TGG2 XP_001646590.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]