SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TGU6|A7TGU6_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TGU6|A7TGU6_VANPO
Domain Number 1 Region: 3-170,205-322
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.11e-75
Family WD40-repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 381-602
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000000204
Family Quinohemoprotein amine dehydrogenase B chain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TGU6|A7TGU6_VANPO
Sequence length 1206
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_2001p65
Sequence
MKLLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRYEDHEGPVRGID
FHPTQPLFVSAGDDYTIKVWSLETNKCLYTLDGHLDYVRTVFFHKELPWIISASDDQTIR
IWNWQNRKEIACITGHNHFVMCAQFHPTEDLIVSASLDETVRVWDISKLREKHSAPGRSA
MPTSFEEKIAAQQNLLDGGFGDCTVKFILEGHTRGVNWASFHPTLPLIVSGGDDRQVKLW
KMSATKAWELDSCRGHTNNVDSVIFHPTQNLILSVGEDKTLRVWDLDKRTPVKQFKREND
RFWLIAAHPNINLFGAAHDSGIMIFKLDRERPPFAIHQNMLYFVNNEKQVQTFDFPNQVS
SLPYASLKSLGNPWEAFKSISYNPSQNSLLVSEGNNKFGLVLLTKQPTGAVQPTGVMEDN
GSFATFVARNRFVVYNNANDTLEVRSLENKVTKAIKIDGNVKGLAHGGPGLILVLLTKSV
LLYDVQQGKQLAEMSLKNVKYVSWSQDGQYVALISKHTITITNKRLELVSTRHETIRVKS
AAWDESNVLIYSTLNHIKYILLNGDNGIIKTLEKTLYITRVQGKLIYALNRDGEVQILSI
DPTEYRFKKSLVNKNYPEVMRIIKNSNLVGQSIISYLQKAGHPDVALQFVQDPQTRFDLA
VEYGNLDVALLEAKKLNAPASWERLRKEAVTQGNLGIVELIDQQLKSFDQLSFLYLISGE
TNKLSKMETVAQRRNDVSSMILNSFYNNSVSFRSNVFAEAGSLPLAYAVAKANGDEAAAA
AYLEQAGIDEQDVTLPDVLNPSSFTKAPVITEPMEKWPLKEAELSYFEKAVLGQIEDLHL
DEPQGQETIERPHVDEEGDVFFEGEEVAEDDGAWDMGSEDLDVGEEFEAVEEKEEEEPVS
IEESETATWVKNSKLPAVLIAAGAFDAAAQALNKQVGIVNFEPLRKNFLDVYEGCRTYMP
GEPEEIPALVGYTRIIADAEQTGEILPYVAGVSAITEKMNIGFKSFKANKLEDAIESFRS
AIYNITLLTVYNEEDEKFARSALEKAREYILGLSIELARRALPEDEIKRNLELATYFTRA
KLAPAHHSNALQVAMSQNFKHKNFVQASYFAGEFLKIVTTGPRAEQARKIKDKSDSIASD
AIELDFDPYAEFDICAASYTPIYKGTPSVSDPLTGAKYHASEKDKIDRIALVSKIGAVAS
GLRILL
Download sequence
Identical sequences A7TGU6
XP_001646417.1.22633 436907.A7TGU6 tr|A7TGU6|A7TGU6_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]