SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TI16|A7TI16_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TI16|A7TI16_VANPO
Domain Number 1 Region: 165-412
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.71e-41
Family Regulator of chromosome condensation RCC1 0.024
Further Details:      
 
Domain Number 2 Region: 791-863,908-937
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000942
Family BTB/POZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TI16|A7TI16_VANPO
Sequence length 1366
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1045p7
Sequence
MPIKKQSNDINRNKRDIFGRDLSYLLSCIEEEGDLNEIDLYSSDYESGYSPLHVTLKRGL
LRKSFKLYKIWKDEKEYLSHKFGGHVMNQLDREGLTPLELYSEEYRRLVNKFPLYLGYRT
ENGLSNVHWEGSKNSDEVKRHVKNFLSLPLEKLEQDKLQHLGGSHVLQLGSNVNYQLGTG
TKDDRQNFYQINVHQLETSSMLLPNLRIRNSYITRYHSLIITSNNEIFTCGNSNRGRVGN
GVIDLPQSHYAKVDGLPKLEIKEIKTSDHHTMVLYKNGDIYSWGWNYYGQLGHSMSRQLD
DPKNSHNVCSMVPKRLTILENEEITSISCSKIHSCVVTKKGQIYLWGLNVGQLGSSKPSH
LVPSTEYMGQEGFLVNKPVVVNFLNSAIEQVVCTEFATFIRTQGNTLHVLSNYTTRTFRL
YLPKSKGFRELDAFKHFSPREIPNTIVDMKCKNPYGNNICFRYSCGRVAIISAKNESPSL
WAKFSNIPPISVCWLPRHSFKQCLDFDVGSRKGIILSTIGGDIYTSKSTDGTFEKIFSEK
IVSGRIISVSCDSQFGSFSITKDEVNNIPIIYPKDPLRYNFSSYSPIKGFSNSKKDINYG
ILNFKEFEADDYSANYPLDTKTINDEYEGPLVLKNQKFQYAELKNKNITSISQHSEISVP
YDVTFIDEFSGEIICNCHKLLIHMRCNKLLKRWKLSEPYIFNNGKSKLTLLSPFESSKWT
VKLETTNGDFNFKNYLLDVIHYLYSDERPNDQKVSRFLIDLVDNSLHYSNMSESLHNLFT
ICQGEIFDACAEPDVRIITNDGIISAHSMILATRSSYFDSLFAANWIPRDHENNRVVDFS
HFNHISKSHFECILKYLYGYSYDSIFDDLSVGSMTTGLQFLFDLVELCDEINLEQFKNYL
ESEIGKYIEGSNIVSVFINAVFYNCELLQIKCAWIITSNIGILFSKSNVDLIMEYFDDEI
WNILENSLLELKESSIRTTEDRSWYTNSSFGWIQQFKTNLQEFNRKFMGLETFNPSFDNK
VVMSNCKEKATPRRASSGVLSGSTRRLSSTQRKFSNDHKQLEISSSYSLSNWSDLSISES
SAIDDSDNFIEVVKKSKRKGSLEPSKEIEEVKVNLEEQNISVVHKDIVEVNEKLPSLLSL
NEDAPDNNSNLNKPINKQIGSFKKNSQKQRKKQFLFEESEEEKKGKEKAFQKSKAAWGKY
NCEEKENINQKTTITTESKKVSRPSSLPSLYDSREANETKSKKNKVPKNISKDNLHMPFY
NASKLVPRNAIDVMLDKEKLGIVEPTMLSESEREAAEEFEKWFASESKKVQKQLNKISSN
NVTDQLDVLYRSSTNVPGTTNLNGQSKSKKVKFPRKKRGLTEQIEI
Download sequence
Identical sequences A7TI16
XP_001645881.1.22633 436907.A7TI16 tr|A7TI16|A7TI16_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]