SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TI53|A7TI53_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TI53|A7TI53_VANPO
Domain Number 1 Region: 232-370
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000254
Family CBS-domain pair 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TI53|A7TI53_VANPO
Sequence length 547
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1045p47
Sequence
MHRLVYTLLPLLVHTNPILSQALPLQLIANNKDDAGDLIEESSKLYYLITSISLVLLGGV
FAGLTLGLMGQDEIYLKVISSSGSPQEQVLAKTVLNLLSRGKHQILVTLLLSNVITNETL
PIVLDRLIGEGGGWKAILFSTILIVIFGEIIPQSICVKYGLQIGSWLSPFVTVLMYILWP
IAWPIAKLLDHVLGENHGTMYKKSGLKTLVNLHQTNGIERLTQDEVTIITAVLDLKDKFV
MEIMTPINKVFTLSSDTVLDQSNVDNIYKSGYSRIPIHLPNDPTNFVGMLLVKILISYDP
EDSWKVSQFPLATLPETLPTTSSLNILNYFQQGKSHMCIVSESPGEPLGALGIVTLEDVI
EELIGEEIIDESDVIADEDHTCDVHTPLLKRNLPIASENNTTTTTHRSSLTAPSSLSKIP
SNLASNPLDVENSFVKIKRNYPIKSSTNSSSNHNLSNYNSHSSLTTNGSNKNMDIDRPSI
PMAMKKNKQNENTVENNNGIVESVITIKGVPKTIIQSTDFKFSKQNSSTDSNIDHSQSDE
SNYRERR
Download sequence
Identical sequences A7TI53
tr|A7TI53|A7TI53_VANPO XP_001645918.1.22633 436907.A7TI53

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]