SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQ63|A7TQ63_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQ63|A7TQ63_VANPO
Domain Number 1 Region: 19-285
Classification Level Classification E-value
Superfamily ARM repeat 1.15e-16
Family PBS lyase HEAT-like repeat 0.074
Further Details:      
 
Domain Number 2 Region: 1150-1425
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000229
Family Tropomyosin 0.00066
Further Details:      
 
Domain Number 3 Region: 2120-2354
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000589
Family Tropomyosin 0.0015
Further Details:      
 
Domain Number 4 Region: 970-1225
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000105
Family Tropomyosin 0.00094
Further Details:      
 
Domain Number 5 Region: 1834-2060
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000785
Family Tropomyosin 0.00064
Further Details:      
 
Domain Number 6 Region: 750-958
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000196
Family Tropomyosin 0.0016
Further Details:      
 
Weak hits

Sequence:  tr|A7TQ63|A7TQ63_VANPO
Domain Number - Region: 2381-2489
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0863
Family Myosin rod fragments 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQ63|A7TQ63_VANPO
Sequence length 2546
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_483p11
Sequence
MDLIQGIIQPPRVQTADETIPTLCDRLENGTLISDRRSAILALKSFSREFRETVIASGLK
TLINTLKRDSMDEDTVKAILETLLILFIRGDGNDDLTRNWISLQSRMQNGKYPSPLVMKE
EKEHVDQFSMWIADALTQNDEMVHLLIDFLNIESFHIKLYATQLLEAVIATRPSRSREAI
TSLPIGVSSMVSLLDDIHEPIRDEAVLLLMAVVNDSPHVQKLVAFENIFDRLFSIIHEEG
GLRGSLIVNDCLSLINNILKYNNSNQNLFVETGNLPKLAYLLSEPLSDTEEFFWNEQRIK
NINAALDIVKLTVEPGSTTTRKHQDALLDTKLLMVVLRIAFHYSIPKKVRPNGLLTAADM
IRDNEIAQTEFGKIDVPFFDPSLPPDVTQKDVKLVPVVALLLNWALYANSVHTFTTRAAS
VVLLKSYLNGNHELQTEFLERQIRLYSNPTENDEDAVLLPNFKYNIFEAILDYDPDLKLN
PYKIYFSSDIFMFFFDPENENSSKYRDMAREVKTGEISDDVDTLKSIQGISELLLTTLTS
EDIRIPISYISLLIYWLYGDFNAVNDFLTDRATIQSLLSFAYQIQGDDITVKCLVSMLIG
VSYEFSSKDSPYPRKPYHEFITKSIGVDNYSSRIKQLKDDSLFSKFDHEIDILNPNFDES
GLPEIYFTSYFVDLIKTNFYRLKSALSHDPEQESIAKISFETFDELQRECSKLKGELNDM
FVSKGDVINELELKVEELSNKSKNSISDYESIKNEYDILKNNYEEKEGEFESVSKKLDEL
LTEREKLNSVTSEQLKKLEQNKSDLEKCKLNIEKLENELKEVKERKDNAENGVNKMNKEL
SNLSKEKEQLRIEQGKLEKKIQEQISVYEDSKIKFNQELESTEKQITDLQSNLESKNTEL
DNLNKEKSGLMKELTEWKAKFKSHDALVPKLTEKLKSLANSYKELQTERDNYSSQLIEIN
KNKTSELSSLSESISNLKIEKDKILDEKSKLINKVSELESQITENCKIFEEEKEKLILSK
DELEELVIDLNEQLKELETQKETTSKNADELNKSIANLNTQLKQKDSKLIELEELVEVTK
NNLNDSESQVSNLIAKISELDEENKSVKLEVEKLENEITEIKNSHKSAQKETDTLQTKLD
ETELLLQSSKEEILSLKNEYSSTLSDKENLENSEKKSSEKIEELEKNFSNLQEQFENITA
ENKSLKEECSGTEEKFKDVNEKLDQYGETISSLSDEKDKLNGIIDDKEKIISNLNEKLES
ISEDIDIIEKAKNLLEEKLATMTSELNDSENGSSELRSLYDSLKIEFEELQKTNSDKSAN
LKELENKHTSLTETQEILLEDKKKMESSINDYVKIKDDLEKEKEDLLNKYNVLEDKKDKL
EIILEENNSSIKVLEHSIDALKKENEIYKNEIHDMKLQMESSNSEYKNKAGEQEKKISRL
KEECNKLKNSYEEKIEKLEVESKNLSLGHDTEKKQFEDKITSLKQEIISIEKSKKQDEKV
LKNQKNTLQKELEELKDQFTNSENEYIKKLDNFQNEINSVRKEKLDIEAVLNSKIETLKA
DLSKSEEKSLILEKSNKEHLIKMEVIQKSLEKQNKELDILGNEKDTLTMNLNNEIKGLKE
EINSKVDQIGNLKTELNTVSENMEDIQVRYDQLKEEKSEISDKLIESEEKLKENFSSISD
LNSSVISLEASIISKDEEYTLLKKEFEEVKISKQELDNQKDKLLEEYSIMKRTNESKLKD
LRNELDSKIIKFDKERKLLNEGSDNIAQEYSEKVTSLEEELRNQKIYSDDKISELEENIK
SKNNALTEKSNLLQKRLEEIKELESTLSKYKADLEATMKNSDLKNDEFENVCKELSVKEN
EIKKIEEILSSKEDLIAEIESQKDNLKDELNEKSLLLDKKESQLEAFQEDVEVQKENLQK
KITEYDNLQKLMSLDNKKLVKCEKQIEDLELKLESSSNHLKEQEGKYEKLEFESGENKKL
ISEKDELIQTLQLDISNNKDEIQKLSDKISTLQNNSENTELTLEEKEKMVDELNSKLQEK
EAQVETLELDLNKLKETLDKELESSSELQIAHDNLRDENIIQKQKITELKVKIDDSEKDS
QVIIDNMKEMEENIMDLRNDLSSKTIQIEKVNEDLSSKNSEIEQLNKKLAEKCAEYDSIK
SELVASSKLSESEKNDMKQLSDEINELKEQLELKNENLKKVTSDLQIANNTSDKYNDELK
VANNTIREIESKIPNLQKQLDLKEIEYNDTLSSKKDLDKKLDNFSKESEILSKEVKSLKK
EKLDLEKEKNDLIVELDKYKNDIIDLNNTLKENEKNGSEVETEIIGLKDKIEFYKLNVSQ
LNEEKGKLESDIKTLVGERDDKLKSSQSEIIELTNKLESFKDISVAYEESKVESDGLKNK
LSEIEKSLEESNENVDSANKEISDLKVMNDKLQSHNLELEDKFQQLKNDTTETNRKIQDI
NKLKEEESSKAEEKIRSLTEEIEKLKNDFKKNESKAPDTSEIDDLMLLVSDLDEKNSKYK
AKLEELGVELSSDEETESDDTDEEEG
Download sequence
Identical sequences A7TQ63
436907.A7TQ63 tr|A7TQ63|A7TQ63_VANPO XP_001643450.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]