SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TQG5|A7TQG5_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TQG5|A7TQG5_VANPO
Domain Number 1 Region: 325-601
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.13e-42
Family WD40-repeat 0.0000000319
Further Details:      
 
Domain Number 2 Region: 23-355
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-40
Family WD40-repeat 0.00000000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TQG5|A7TQG5_VANPO
Sequence length 604
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_467p21
Sequence
MSITLKNIIPPQPSTERNFSTHIDYDEATNSIAYPSGRNAFIRSLDNDSVVQFTGHGSSN
VNVVKFSPIKNSQYLCSGDASGKVIVWGWSSNDDVVETIVKAEYQALAGPILDISWDFEG
KRLCIVGEGREQYGIFISWDSGNSLGEISGHSKRINSCHFKQSRPMRCMTVSDDGSAVFY
QGPPFKFTASDRIHHDQGKFIRDVEFSPNSGDYAVSVGSDRKICCFDGKTGEFIKYIEDP
NETIEGGLFAVSWVDEKRFVTASADAAVRLWSVEEPKCLQKWLIPESIPYGNQQIGVIAA
KDEQVVSLSLDGSLNFFKIGNDTVVKTIVGHNKGITALTVNPLVSGSYDGRVIEWEGTQP
KANYYHNNLIVAIDSSTKGCISTVSWDDTLKTNGVTKFEFNDQPSIASADGTGSIAVIAG
GVTLSIFNSETGEVLNSIELDRPASAIDLHKDLVAVGYEHSNIIEIFKATELTNSYKLNT
ALQAKPSCISISPSGRYVAAGDVSGKIILYDLENKDVKTTRWSFHTSKINCITWRPSEDG
EENHVVTGSLDTNIFIYSVERPMKIVKYLNAHKDGVSVVQWKDTDTIVSAGADACIKEWS
VETQ
Download sequence
Identical sequences A7TQG5
tr|A7TQG5|A7TQG5_VANPO XP_001643367.1.22633 436907.A7TQG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]