SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gb|PVX_000600 from Plasmodium vivax SaI-1 7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|PVX_000600
Domain Number 1 Region: 60-381,410-498
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.7e-80
Family Cystathionine synthase-like 0.00000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gb|PVX_000600
Sequence length 510
Comment | organism=Plasmodium_vivax_SaI-1 | product=cysteine desulfurase, putative | location=CM000444:443108-444763(+) | length=510
Sequence
MRPSSAAWICLLLRIANYTCYSYHVGRSDLYVGRAPRRMTKLSYENGKPHIDAGVVNYFK
QIREEFPFFKRENCPAYFDSAATTQKPACVIGKLTQFYSSENANVHRGIYKMSLDATRSY
EQVRKTIKNFINCEREDEIIFTSGTTHGLNLICSMLMERVIKRRQDEIHLTYLEHHSNIV
PWQEQVKRKKKGKIKYIPLKSTGYIHIKRLRKRINRNTKVVSISHVSNVLGNIQKLTAII
KAVKEKNKNAIVIVDAAQSFAHIRYDLRRMEANNCCPDVLIASGHKFCAPLGCGFMYLKN
TLTCSYKFKPLLYGSNMITTVGKYESEFESPPQLFESGTQNIAGVISMGVAINFLERIDQ
RLLCRYEMFLYDMLVYHLGQHLQRGLVQLPGGVSESGGSSGGSGGSRPTDPCRLYIHNSR
RGGGKKVPILPLWSDQFSSFDLVTFLDFKNVCIRSGHHCASLLLKEFLRIPDCARVSLFF
YNTPEEVQFLAEQIASIARMLSGMNRGGVK
Download sequence
Identical sequences A0A0J9SJA7 A0A0J9T111 A0A0J9TJN0 A0A0J9U0M0 A0A1G4H7G5 A5KAG7
gb|PVX_000600 5855.PVX_000600 XP_001613293.1.43797 gi|156094513|ref|XP_001613293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]