SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gb|PVX_084285 from Plasmodium vivax SaI-1 7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|PVX_084285
Domain Number 1 Region: 31-419,492-541
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.21e-93
Family SepSecS-like 0.000000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gb|PVX_084285
Sequence length 562
Comment | organism=Plasmodium_vivax_SaI-1 | product=UGA suppressor tRNA-associated antigenic protein, putative | location=CM000454:145144-147341(-) | length=562
Sequence
MNTPGVDVRNGKAVQGDICSNRYSLISKQTLNQKENTLWNILNYGRVPNEGLNEITIMSI
LHQISSQNLCNSEKNVKIGERENRIYSALVRNKYIGFGHGIGRSGNLDDVQPKSAGNSVL
AKATTSFVKDLIKSFGIKGCEDVYILPYATGMCLSTCILYTKKEREKSEYVIVSRIDHKT
CYKCIDFCALKYLVVDMVYRDEELHTNLSEIEKLIQTYGEKICCVMSVTSSYAPRNSDDI
VKIGHMCRRYNIPHIINNAFGLQCNYLCKEIQKCFETKGRVDFVVQSCDKNFLVPVNGGI
VFSSDKKKMKELKKHYPGRTPVHAYLDLFITLLELGKRKILNLRKEREENFAWLKNKVST
LCSKYNLSLIKASKNKISMAINLNELYKIYHVENPRSITLLGSLLFYRNVTGHRVICSPL
LIRNGGVDPNGVDTTEQGEPKPNGVSFPNPRNSSEDARPTHSPNNSNQGGVKETSQTHLV
KNENATHAAILGKGLTIGNHTFEHFGCSYDLYPFSYIAFSCVIGIEREELQSFVEKLDDA
IGCFIRRFGRRASPVERSYAPL
Download sequence
Identical sequences A5K0F0
gi|156101662|ref|XP_001616524.1| gb|PVX_084285 5855.PVX_084285 XP_001616524.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]