SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gb|PVX_115310 from Plasmodium vivax SaI-1 7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|PVX_115310
Domain Number 1 Region: 85-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.12e-26
Family Skp1 dimerisation domain-like 0.0000811
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily POZ domain 1.51e-19
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gb|PVX_115310
Sequence length 162
Comment | organism=Plasmodium_vivax_SaI-1 | product=S-phase kinase-associated protein 1A, putative | location=CM000452:155192-156516(+) | length=162
Sequence
MKNDKIKLVSFEGDEFIVDKYTASMSTVILNILEVMTAEEDTIPLPNIKTPILKKIIEYM
EYHINNPAEEIPKPLITSNLQDVVSSWDYDFVNTDKETLYELIEASNYLDIKPLLDLTCG
KIASMMKDKTTEEIRAEFDIVNDFTREEEKQIREENRWCGDI
Download sequence
Identical sequences A0A0J9SCF5 A0A0J9SUZ9 A0A0J9TCH8 A0A0J9TS83 A0A1G4HES9 A5K2S5
gb|PVX_115310 gi|156101517|ref|XP_001616452.1| 5855.PVX_115310 XP_001616452.1.43797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]