SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384412364|ref|YP_005621729.1| from Zymomonas mobilis subsp. mobilis ATCC 10988

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384412364|ref|YP_005621729.1|
Domain Number 1 Region: 119-344,378-522
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9e-48
Family AAT-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384412364|ref|YP_005621729.1|
Sequence length 530
Comment class I and II aminotransferase [Zymomonas mobilis subsp. mobilis ATCC 10988]
Sequence
MTTDYSKYKNLSPFELKDELIRIASSRTDRLMLNAGRGNPNFLATLPRSAFFNLGQFAVS
ESELSFSYMTVGVGGQARVEGIEERFERFISENRHKAGIFFLGRALSYVRDQLGLSASQF
LHEMVEGILGCNYPTPPRMLSLSEQIVGQYVLREMVGSDLPTDSTDFFATEGGTAAMAYI
FNSLKQNNLIKKGDKVAIGMPIFSPYIEIPQLEEYGLEEVAIQADPNLNWQYPDEELEKL
KDPAVKIFFCVNPSNPPSVKMNDASLKKIADIVAHHRPDLMILTDDVYGTFADDFHSLFA
VCPENTILVYSFSKYFGATGWRLGVIGTHKNNVMDRLLQALPNEKKEALSRRYSSLTTEA
ENLKFIDRLVADSRAVALNHTAGISTPQQVQMVLFSLFALMDSKEDYKATIKNVIRRREA
ALYRELGVKPSEDANAVDYYTLLDLETVCRALYGEKFAQWMSDRSSSAEILFRIAEETGI
VLLPGEGFGVQKPAARASLANLSEYQYAAIGRSLRKLADEYYQAFLKANG
Download sequence
Identical sequences A0A0H3G3D0 Q5NLV4
gi|56552578|ref|YP_163417.1| 264203.ZMO1682 622759.Za10_1537 WP_011241430.1.26972 WP_011241430.1.32473 WP_011241430.1.33991 WP_011241430.1.34904 WP_011241430.1.41889 WP_011241430.1.4952 WP_011241430.1.67824 WP_011241430.1.74559 WP_011241430.1.88046 gi|560137359|ref|YP_008833988.1| gi|260753766|ref|YP_003226659.1| gi|384412364|ref|YP_005621729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]