SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379702480|ref|YP_005244208.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379702480|ref|YP_005244208.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.46e-111
Family FMN-linked oxidoreductases 0.0000000000458
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.94e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000929
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.67e-27
Family C-terminal domain of adrenodoxin reductase-like 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379702480|ref|YP_005244208.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAQGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYASRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPITPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDVTGVTLKLNQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
ALTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
AGGLRPEGPRLARSPRQIVMLQRKTSKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A0D6ICE6 A0A0F6B703 A0A0F7DJI8 A0A0H3NG62 A0A0U1IBU1 A0A0W4VHV9 A0A249UTZ7 A0A2D3AGK6 A0A2H9YJ63 E8XBE7 Q8ZLX6
gi|378446607|ref|YP_005234239.1| gi|16766518|ref|NP_462133.1| gi|383497877|ref|YP_005398566.1| gi|378990537|ref|YP_005253701.1| gi|526221573|ref|YP_008267423.1| gi|525836934|ref|YP_008253598.1| gi|378701123|ref|YP_005183080.1| ABAM02000001|CDS_3759950-3761968 ABAO01000002|CDS_75827-73809 AE006468|CDS_3386255-3388273 CP001363|CDS_3404508-3406526 FN424405|CDS_3408680-3410698 gi|378985817|ref|YP_005248973.1| 99287.STM3219 gi|550902578|ref|YP_008671670.1| IDP01051 NP_462133.1.58477 WP_000121523.1.100010 WP_000121523.1.100234 WP_000121523.1.100258 WP_000121523.1.100376 WP_000121523.1.100424 WP_000121523.1.100436 WP_000121523.1.100484 WP_000121523.1.100488 WP_000121523.1.100597 WP_000121523.1.10076 WP_000121523.1.100781 WP_000121523.1.100793 WP_000121523.1.100869 WP_000121523.1.100871 WP_000121523.1.100882 WP_000121523.1.101007 WP_000121523.1.101020 WP_000121523.1.101074 WP_000121523.1.101078 WP_000121523.1.101180 WP_000121523.1.101259 WP_000121523.1.101284 WP_000121523.1.101291 WP_000121523.1.101320 WP_000121523.1.101353 WP_000121523.1.101386 WP_000121523.1.101404 WP_000121523.1.101420 WP_000121523.1.101589 WP_000121523.1.101707 WP_000121523.1.101734 WP_000121523.1.101878 WP_000121523.1.101953 WP_000121523.1.10220 WP_000121523.1.10266 WP_000121523.1.10439 WP_000121523.1.10678 WP_000121523.1.10753 WP_000121523.1.10992 WP_000121523.1.11000 WP_000121523.1.11024 WP_000121523.1.11031 WP_000121523.1.11098 WP_000121523.1.11168 WP_000121523.1.11190 WP_000121523.1.11295 WP_000121523.1.11455 WP_000121523.1.11458 WP_000121523.1.11518 WP_000121523.1.11532 WP_000121523.1.11543 WP_000121523.1.11763 WP_000121523.1.11772 WP_000121523.1.11897 WP_000121523.1.12025 WP_000121523.1.12114 WP_000121523.1.12351 WP_000121523.1.12370 WP_000121523.1.12546 WP_000121523.1.1264 WP_000121523.1.12728 WP_000121523.1.12936 WP_000121523.1.12995 WP_000121523.1.13027 WP_000121523.1.13106 WP_000121523.1.13130 WP_000121523.1.13334 WP_000121523.1.13414 WP_000121523.1.13488 WP_000121523.1.13509 WP_000121523.1.13669 WP_000121523.1.13741 WP_000121523.1.1387 WP_000121523.1.13908 WP_000121523.1.13932 WP_000121523.1.13968 WP_000121523.1.14001 WP_000121523.1.14151 WP_000121523.1.14239 WP_000121523.1.14320 WP_000121523.1.14379 WP_000121523.1.14406 WP_000121523.1.14410 WP_000121523.1.14466 WP_000121523.1.14524 WP_000121523.1.14554 WP_000121523.1.14725 WP_000121523.1.14852 WP_000121523.1.1489 WP_000121523.1.14932 WP_000121523.1.15055 WP_000121523.1.15124 WP_000121523.1.15223 WP_000121523.1.15226 WP_000121523.1.15316 WP_000121523.1.15369 WP_000121523.1.1540 WP_000121523.1.15508 WP_000121523.1.15784 WP_000121523.1.15830 WP_000121523.1.16062 WP_000121523.1.16063 WP_000121523.1.16103 WP_000121523.1.16233 WP_000121523.1.16284 WP_000121523.1.16328 WP_000121523.1.1635 WP_000121523.1.16468 WP_000121523.1.16614 WP_000121523.1.16650 WP_000121523.1.16686 WP_000121523.1.16691 WP_000121523.1.167 WP_000121523.1.16732 WP_000121523.1.16735 WP_000121523.1.16786 WP_000121523.1.16858 WP_000121523.1.1689 WP_000121523.1.16896 WP_000121523.1.16916 WP_000121523.1.16965 WP_000121523.1.1700 WP_000121523.1.17307 WP_000121523.1.174 WP_000121523.1.17480 WP_000121523.1.17546 WP_000121523.1.17702 WP_000121523.1.17705 WP_000121523.1.17747 WP_000121523.1.17755 WP_000121523.1.18019 WP_000121523.1.18111 WP_000121523.1.18163 WP_000121523.1.18265 WP_000121523.1.18267 WP_000121523.1.18282 WP_000121523.1.18468 WP_000121523.1.18607 WP_000121523.1.18705 WP_000121523.1.18715 WP_000121523.1.18776 WP_000121523.1.18822 WP_000121523.1.18881 WP_000121523.1.18940 WP_000121523.1.18949 WP_000121523.1.19053 WP_000121523.1.19320 WP_000121523.1.19458 WP_000121523.1.19460 WP_000121523.1.19461 WP_000121523.1.19614 WP_000121523.1.19642 WP_000121523.1.19702 WP_000121523.1.19706 WP_000121523.1.19724 WP_000121523.1.19749 WP_000121523.1.19784 WP_000121523.1.19802 WP_000121523.1.19809 WP_000121523.1.19867 WP_000121523.1.1998 WP_000121523.1.20 WP_000121523.1.2010 WP_000121523.1.20212 WP_000121523.1.20266 WP_000121523.1.20271 WP_000121523.1.20330 WP_000121523.1.20362 WP_000121523.1.20418 WP_000121523.1.20525 WP_000121523.1.2054 WP_000121523.1.20553 WP_000121523.1.20626 WP_000121523.1.20646 WP_000121523.1.20886 WP_000121523.1.20908 WP_000121523.1.21049 WP_000121523.1.21146 WP_000121523.1.21245 WP_000121523.1.21246 WP_000121523.1.21269 WP_000121523.1.21400 WP_000121523.1.21497 WP_000121523.1.21499 WP_000121523.1.21548 WP_000121523.1.21603 WP_000121523.1.21751 WP_000121523.1.21757 WP_000121523.1.22024 WP_000121523.1.2205 WP_000121523.1.22062 WP_000121523.1.22067 WP_000121523.1.2221 WP_000121523.1.2235 WP_000121523.1.22379 WP_000121523.1.22427 WP_000121523.1.2246 WP_000121523.1.22485 WP_000121523.1.22537 WP_000121523.1.22620 WP_000121523.1.22870 WP_000121523.1.22979 WP_000121523.1.23102 WP_000121523.1.23114 WP_000121523.1.2314 WP_000121523.1.23192 WP_000121523.1.23259 WP_000121523.1.23460 WP_000121523.1.23472 WP_000121523.1.23482 WP_000121523.1.23634 WP_000121523.1.2364 WP_000121523.1.23932 WP_000121523.1.24017 WP_000121523.1.24206 WP_000121523.1.24308 WP_000121523.1.24578 WP_000121523.1.24737 WP_000121523.1.24779 WP_000121523.1.25008 WP_000121523.1.25015 WP_000121523.1.25206 WP_000121523.1.25454 WP_000121523.1.25493 WP_000121523.1.25668 WP_000121523.1.2570 WP_000121523.1.25740 WP_000121523.1.25814 WP_000121523.1.25988 WP_000121523.1.26311 WP_000121523.1.26319 WP_000121523.1.26429 WP_000121523.1.26440 WP_000121523.1.26493 WP_000121523.1.26551 WP_000121523.1.26567 WP_000121523.1.27010 WP_000121523.1.27173 WP_000121523.1.27206 WP_000121523.1.27423 WP_000121523.1.2763 WP_000121523.1.27665 WP_000121523.1.27707 WP_000121523.1.27755 WP_000121523.1.27761 WP_000121523.1.2777 WP_000121523.1.27857 WP_000121523.1.27977 WP_000121523.1.28094 WP_000121523.1.28126 WP_000121523.1.28170 WP_000121523.1.28302 WP_000121523.1.2835 WP_000121523.1.28370 WP_000121523.1.28538 WP_000121523.1.28575 WP_000121523.1.28625 WP_000121523.1.28655 WP_000121523.1.28694 WP_000121523.1.2879 WP_000121523.1.2890 WP_000121523.1.28938 WP_000121523.1.28946 WP_000121523.1.29006 WP_000121523.1.29010 WP_000121523.1.2910 WP_000121523.1.29588 WP_000121523.1.29601 WP_000121523.1.29606 WP_000121523.1.29615 WP_000121523.1.29619 WP_000121523.1.29704 WP_000121523.1.29969 WP_000121523.1.30006 WP_000121523.1.30027 WP_000121523.1.30180 WP_000121523.1.30469 WP_000121523.1.30505 WP_000121523.1.30507 WP_000121523.1.30535 WP_000121523.1.30547 WP_000121523.1.30794 WP_000121523.1.30833 WP_000121523.1.30835 WP_000121523.1.30972 WP_000121523.1.31 WP_000121523.1.31185 WP_000121523.1.3119 WP_000121523.1.31190 WP_000121523.1.31195 WP_000121523.1.31196 WP_000121523.1.31219 WP_000121523.1.31281 WP_000121523.1.31362 WP_000121523.1.31504 WP_000121523.1.31515 WP_000121523.1.31578 WP_000121523.1.31658 WP_000121523.1.31940 WP_000121523.1.31967 WP_000121523.1.31972 WP_000121523.1.32192 WP_000121523.1.32206 WP_000121523.1.32438 WP_000121523.1.32515 WP_000121523.1.32527 WP_000121523.1.32660 WP_000121523.1.32702 WP_000121523.1.32714 WP_000121523.1.32786 WP_000121523.1.32804 WP_000121523.1.32860 WP_000121523.1.32907 WP_000121523.1.33030 WP_000121523.1.33127 WP_000121523.1.33248 WP_000121523.1.33261 WP_000121523.1.333 WP_000121523.1.33492 WP_000121523.1.33553 WP_000121523.1.33592 WP_000121523.1.33894 WP_000121523.1.34043 WP_000121523.1.34075 WP_000121523.1.34257 WP_000121523.1.34279 WP_000121523.1.34319 WP_000121523.1.34453 WP_000121523.1.34610 WP_000121523.1.34856 WP_000121523.1.34975 WP_000121523.1.34977 WP_000121523.1.35045 WP_000121523.1.35129 WP_000121523.1.35184 WP_000121523.1.35404 WP_000121523.1.35408 WP_000121523.1.35425 WP_000121523.1.35429 WP_000121523.1.35446 WP_000121523.1.35463 WP_000121523.1.35503 WP_000121523.1.35509 WP_000121523.1.35590 WP_000121523.1.35940 WP_000121523.1.36003 WP_000121523.1.3601 WP_000121523.1.36609 WP_000121523.1.36690 WP_000121523.1.3670 WP_000121523.1.36705 WP_000121523.1.36918 WP_000121523.1.36931 WP_000121523.1.37063 WP_000121523.1.37073 WP_000121523.1.37111 WP_000121523.1.37112 WP_000121523.1.37256 WP_000121523.1.37293 WP_000121523.1.37370 WP_000121523.1.37376 WP_000121523.1.3744 WP_000121523.1.37498 WP_000121523.1.37504 WP_000121523.1.37618 WP_000121523.1.37687 WP_000121523.1.37968 WP_000121523.1.37978 WP_000121523.1.38125 WP_000121523.1.38145 WP_000121523.1.383 WP_000121523.1.3848 WP_000121523.1.38613 WP_000121523.1.38673 WP_000121523.1.3869 WP_000121523.1.38693 WP_000121523.1.38773 WP_000121523.1.38882 WP_000121523.1.38913 WP_000121523.1.39003 WP_000121523.1.39136 WP_000121523.1.39229 WP_000121523.1.39405 WP_000121523.1.39420 WP_000121523.1.39449 WP_000121523.1.39512 WP_000121523.1.39556 WP_000121523.1.39629 WP_000121523.1.39763 WP_000121523.1.39862 WP_000121523.1.39921 WP_000121523.1.39923 WP_000121523.1.40017 WP_000121523.1.40072 WP_000121523.1.40073 WP_000121523.1.4011 WP_000121523.1.40208 WP_000121523.1.40240 WP_000121523.1.40257 WP_000121523.1.40292 WP_000121523.1.40305 WP_000121523.1.40311 WP_000121523.1.40380 WP_000121523.1.40395 WP_000121523.1.40465 WP_000121523.1.40508 WP_000121523.1.40710 WP_000121523.1.4075 WP_000121523.1.4087 WP_000121523.1.40877 WP_000121523.1.41017 WP_000121523.1.41086 WP_000121523.1.41091 WP_000121523.1.41226 WP_000121523.1.41516 WP_000121523.1.41554 WP_000121523.1.41572 WP_000121523.1.41591 WP_000121523.1.41662 WP_000121523.1.41708 WP_000121523.1.41761 WP_000121523.1.41859 WP_000121523.1.41882 WP_000121523.1.41979 WP_000121523.1.41985 WP_000121523.1.42104 WP_000121523.1.42320 WP_000121523.1.42342 WP_000121523.1.42422 WP_000121523.1.4276 WP_000121523.1.42864 WP_000121523.1.4288 WP_000121523.1.43018 WP_000121523.1.43041 WP_000121523.1.43244 WP_000121523.1.43312 WP_000121523.1.43334 WP_000121523.1.43351 WP_000121523.1.43437 WP_000121523.1.43522 WP_000121523.1.43613 WP_000121523.1.43668 WP_000121523.1.43886 WP_000121523.1.44005 WP_000121523.1.44043 WP_000121523.1.44099 WP_000121523.1.44121 WP_000121523.1.44291 WP_000121523.1.44310 WP_000121523.1.44386 WP_000121523.1.44479 WP_000121523.1.44640 WP_000121523.1.4467 WP_000121523.1.44747 WP_000121523.1.4485 WP_000121523.1.44877 WP_000121523.1.44927 WP_000121523.1.44971 WP_000121523.1.45067 WP_000121523.1.45074 WP_000121523.1.45079 WP_000121523.1.45098 WP_000121523.1.45177 WP_000121523.1.45184 WP_000121523.1.45259 WP_000121523.1.45344 WP_000121523.1.45349 WP_000121523.1.45365 WP_000121523.1.45550 WP_000121523.1.45585 WP_000121523.1.45690 WP_000121523.1.45797 WP_000121523.1.458 WP_000121523.1.46011 WP_000121523.1.46069 WP_000121523.1.46112 WP_000121523.1.46173 WP_000121523.1.46174 WP_000121523.1.46187 WP_000121523.1.46303 WP_000121523.1.46595 WP_000121523.1.46675 WP_000121523.1.46930 WP_000121523.1.47057 WP_000121523.1.47214 WP_000121523.1.47429 WP_000121523.1.47448 WP_000121523.1.4747 WP_000121523.1.47472 WP_000121523.1.47478 WP_000121523.1.47621 WP_000121523.1.47799 WP_000121523.1.48242 WP_000121523.1.48253 WP_000121523.1.483 WP_000121523.1.48367 WP_000121523.1.48377 WP_000121523.1.4853 WP_000121523.1.48788 WP_000121523.1.4885 WP_000121523.1.48894 WP_000121523.1.48919 WP_000121523.1.49084 WP_000121523.1.49155 WP_000121523.1.49175 WP_000121523.1.49204 WP_000121523.1.49239 WP_000121523.1.49256 WP_000121523.1.49290 WP_000121523.1.49340 WP_000121523.1.49366 WP_000121523.1.49490 WP_000121523.1.49515 WP_000121523.1.49572 WP_000121523.1.4979 WP_000121523.1.49803 WP_000121523.1.49805 WP_000121523.1.49929 WP_000121523.1.50080 WP_000121523.1.50161 WP_000121523.1.50211 WP_000121523.1.50376 WP_000121523.1.50389 WP_000121523.1.50676 WP_000121523.1.50774 WP_000121523.1.50804 WP_000121523.1.50808 WP_000121523.1.5088 WP_000121523.1.50908 WP_000121523.1.50941 WP_000121523.1.51014 WP_000121523.1.51022 WP_000121523.1.51179 WP_000121523.1.51182 WP_000121523.1.51186 WP_000121523.1.51487 WP_000121523.1.51488 WP_000121523.1.51634 WP_000121523.1.51649 WP_000121523.1.51686 WP_000121523.1.51911 WP_000121523.1.51932 WP_000121523.1.51989 WP_000121523.1.52121 WP_000121523.1.52148 WP_000121523.1.52346 WP_000121523.1.52353 WP_000121523.1.52361 WP_000121523.1.52653 WP_000121523.1.52743 WP_000121523.1.52857 WP_000121523.1.52898 WP_000121523.1.52915 WP_000121523.1.53190 WP_000121523.1.53406 WP_000121523.1.53436 WP_000121523.1.53466 WP_000121523.1.53543 WP_000121523.1.53757 WP_000121523.1.53812 WP_000121523.1.54033 WP_000121523.1.54075 WP_000121523.1.54196 WP_000121523.1.542 WP_000121523.1.54209 WP_000121523.1.54271 WP_000121523.1.54273 WP_000121523.1.54274 WP_000121523.1.54319 WP_000121523.1.54364 WP_000121523.1.54400 WP_000121523.1.54644 WP_000121523.1.54662 WP_000121523.1.54722 WP_000121523.1.54749 WP_000121523.1.54764 WP_000121523.1.55008 WP_000121523.1.55152 WP_000121523.1.55156 WP_000121523.1.55285 WP_000121523.1.55475 WP_000121523.1.55647 WP_000121523.1.55706 WP_000121523.1.55743 WP_000121523.1.55768 WP_000121523.1.55782 WP_000121523.1.55796 WP_000121523.1.55993 WP_000121523.1.56002 WP_000121523.1.56012 WP_000121523.1.56105 WP_000121523.1.56238 WP_000121523.1.56286 WP_000121523.1.56304 WP_000121523.1.56414 WP_000121523.1.56438 WP_000121523.1.56560 WP_000121523.1.56597 WP_000121523.1.56601 WP_000121523.1.56614 WP_000121523.1.56671 WP_000121523.1.56682 WP_000121523.1.56875 WP_000121523.1.56877 WP_000121523.1.57125 WP_000121523.1.57168 WP_000121523.1.57187 WP_000121523.1.57232 WP_000121523.1.57377 WP_000121523.1.57433 WP_000121523.1.57515 WP_000121523.1.57529 WP_000121523.1.57576 WP_000121523.1.57601 WP_000121523.1.57607 WP_000121523.1.57763 WP_000121523.1.57862 WP_000121523.1.57890 WP_000121523.1.57891 WP_000121523.1.57978 WP_000121523.1.5801 WP_000121523.1.58041 WP_000121523.1.58418 WP_000121523.1.5854 WP_000121523.1.58548 WP_000121523.1.5858 WP_000121523.1.58662 WP_000121523.1.58669 WP_000121523.1.58745 WP_000121523.1.58803 WP_000121523.1.5886 WP_000121523.1.59094 WP_000121523.1.59224 WP_000121523.1.59375 WP_000121523.1.59458 WP_000121523.1.59490 WP_000121523.1.59508 WP_000121523.1.5953 WP_000121523.1.59684 WP_000121523.1.59694 WP_000121523.1.59771 WP_000121523.1.5979 WP_000121523.1.59953 WP_000121523.1.60008 WP_000121523.1.60021 WP_000121523.1.60069 WP_000121523.1.60140 WP_000121523.1.60155 WP_000121523.1.60285 WP_000121523.1.60379 WP_000121523.1.60464 WP_000121523.1.60874 WP_000121523.1.60941 WP_000121523.1.61078 WP_000121523.1.6114 WP_000121523.1.61232 WP_000121523.1.6129 WP_000121523.1.61296 WP_000121523.1.61345 WP_000121523.1.61417 WP_000121523.1.61574 WP_000121523.1.61609 WP_000121523.1.61712 WP_000121523.1.61714 WP_000121523.1.61730 WP_000121523.1.61857 WP_000121523.1.61918 WP_000121523.1.61952 WP_000121523.1.62007 WP_000121523.1.62025 WP_000121523.1.62204 WP_000121523.1.62304 WP_000121523.1.62364 WP_000121523.1.62374 WP_000121523.1.62403 WP_000121523.1.6253 WP_000121523.1.62570 WP_000121523.1.62853 WP_000121523.1.62903 WP_000121523.1.62910 WP_000121523.1.62955 WP_000121523.1.63063 WP_000121523.1.63181 WP_000121523.1.63203 WP_000121523.1.63256 WP_000121523.1.63290 WP_000121523.1.63382 WP_000121523.1.63461 WP_000121523.1.63479 WP_000121523.1.63577 WP_000121523.1.63664 WP_000121523.1.63718 WP_000121523.1.6375 WP_000121523.1.63757 WP_000121523.1.63834 WP_000121523.1.64046 WP_000121523.1.6423 WP_000121523.1.64244 WP_000121523.1.64403 WP_000121523.1.64649 WP_000121523.1.64702 WP_000121523.1.64757 WP_000121523.1.64781 WP_000121523.1.64831 WP_000121523.1.6489 WP_000121523.1.65018 WP_000121523.1.65028 WP_000121523.1.65171 WP_000121523.1.65248 WP_000121523.1.6535 WP_000121523.1.65572 WP_000121523.1.65633 WP_000121523.1.6565 WP_000121523.1.65696 WP_000121523.1.6575 WP_000121523.1.65782 WP_000121523.1.6630 WP_000121523.1.66314 WP_000121523.1.66358 WP_000121523.1.66362 WP_000121523.1.6638 WP_000121523.1.66600 WP_000121523.1.66698 WP_000121523.1.6680 WP_000121523.1.66834 WP_000121523.1.66901 WP_000121523.1.66962 WP_000121523.1.67037 WP_000121523.1.67045 WP_000121523.1.67181 WP_000121523.1.67268 WP_000121523.1.67347 WP_000121523.1.67552 WP_000121523.1.67682 WP_000121523.1.67829 WP_000121523.1.67887 WP_000121523.1.67905 WP_000121523.1.68073 WP_000121523.1.68201 WP_000121523.1.68206 WP_000121523.1.6827 WP_000121523.1.68275 WP_000121523.1.6849 WP_000121523.1.68547 WP_000121523.1.68589 WP_000121523.1.68655 WP_000121523.1.68656 WP_000121523.1.68778 WP_000121523.1.68787 WP_000121523.1.68894 WP_000121523.1.68928 WP_000121523.1.68975 WP_000121523.1.69006 WP_000121523.1.6913 WP_000121523.1.69146 WP_000121523.1.69255 WP_000121523.1.69397 WP_000121523.1.69564 WP_000121523.1.69644 WP_000121523.1.69704 WP_000121523.1.7016 WP_000121523.1.7021 WP_000121523.1.70241 WP_000121523.1.70269 WP_000121523.1.70289 WP_000121523.1.70447 WP_000121523.1.70485 WP_000121523.1.70643 WP_000121523.1.70683 WP_000121523.1.70883 WP_000121523.1.70922 WP_000121523.1.70948 WP_000121523.1.71116 WP_000121523.1.71146 WP_000121523.1.71165 WP_000121523.1.71188 WP_000121523.1.71202 WP_000121523.1.71243 WP_000121523.1.71306 WP_000121523.1.71337 WP_000121523.1.71378 WP_000121523.1.71401 WP_000121523.1.71481 WP_000121523.1.71691 WP_000121523.1.71702 WP_000121523.1.71750 WP_000121523.1.71845 WP_000121523.1.71881 WP_000121523.1.71908 WP_000121523.1.71952 WP_000121523.1.71973 WP_000121523.1.72105 WP_000121523.1.72203 WP_000121523.1.72372 WP_000121523.1.72376 WP_000121523.1.72594 WP_000121523.1.72871 WP_000121523.1.72975 WP_000121523.1.73062 WP_000121523.1.7315 WP_000121523.1.73200 WP_000121523.1.7334 WP_000121523.1.73377 WP_000121523.1.73481 WP_000121523.1.73561 WP_000121523.1.73581 WP_000121523.1.73617 WP_000121523.1.73667 WP_000121523.1.73753 WP_000121523.1.73758 WP_000121523.1.73794 WP_000121523.1.7387 WP_000121523.1.73924 WP_000121523.1.73926 WP_000121523.1.74029 WP_000121523.1.74181 WP_000121523.1.74191 WP_000121523.1.7433 WP_000121523.1.74379 WP_000121523.1.74410 WP_000121523.1.74466 WP_000121523.1.74529 WP_000121523.1.74745 WP_000121523.1.75129 WP_000121523.1.75187 WP_000121523.1.75288 WP_000121523.1.75334 WP_000121523.1.75362 WP_000121523.1.75385 WP_000121523.1.75392 WP_000121523.1.75760 WP_000121523.1.75764 WP_000121523.1.75828 WP_000121523.1.75837 WP_000121523.1.75874 WP_000121523.1.75945 WP_000121523.1.76020 WP_000121523.1.76252 WP_000121523.1.76445 WP_000121523.1.7660 WP_000121523.1.76673 WP_000121523.1.76706 WP_000121523.1.76721 WP_000121523.1.76756 WP_000121523.1.76760 WP_000121523.1.76875 WP_000121523.1.76880 WP_000121523.1.76899 WP_000121523.1.77038 WP_000121523.1.77047 WP_000121523.1.77080 WP_000121523.1.7712 WP_000121523.1.77180 WP_000121523.1.77244 WP_000121523.1.77292 WP_000121523.1.77349 WP_000121523.1.77514 WP_000121523.1.77529 WP_000121523.1.77549 WP_000121523.1.77692 WP_000121523.1.7782 WP_000121523.1.77851 WP_000121523.1.77898 WP_000121523.1.77918 WP_000121523.1.77960 WP_000121523.1.78033 WP_000121523.1.78076 WP_000121523.1.78096 WP_000121523.1.78100 WP_000121523.1.78110 WP_000121523.1.78120 WP_000121523.1.78383 WP_000121523.1.78407 WP_000121523.1.7861 WP_000121523.1.78618 WP_000121523.1.78735 WP_000121523.1.78802 WP_000121523.1.78830 WP_000121523.1.78835 WP_000121523.1.78871 WP_000121523.1.78874 WP_000121523.1.78918 WP_000121523.1.78930 WP_000121523.1.79151 WP_000121523.1.79167 WP_000121523.1.79335 WP_000121523.1.79462 WP_000121523.1.79472 WP_000121523.1.79490 WP_000121523.1.79495 WP_000121523.1.79529 WP_000121523.1.79570 WP_000121523.1.7964 WP_000121523.1.79659 WP_000121523.1.79668 WP_000121523.1.79708 WP_000121523.1.79845 WP_000121523.1.80077 WP_000121523.1.80137 WP_000121523.1.80182 WP_000121523.1.80296 WP_000121523.1.80366 WP_000121523.1.80780 WP_000121523.1.80831 WP_000121523.1.80850 WP_000121523.1.80881 WP_000121523.1.8096 WP_000121523.1.81037 WP_000121523.1.81069 WP_000121523.1.81175 WP_000121523.1.8119 WP_000121523.1.81193 WP_000121523.1.81354 WP_000121523.1.81410 WP_000121523.1.81425 WP_000121523.1.81750 WP_000121523.1.81785 WP_000121523.1.81902 WP_000121523.1.81974 WP_000121523.1.82479 WP_000121523.1.82503 WP_000121523.1.82515 WP_000121523.1.82676 WP_000121523.1.82761 WP_000121523.1.8282 WP_000121523.1.82944 WP_000121523.1.82956 WP_000121523.1.83092 WP_000121523.1.83163 WP_000121523.1.83305 WP_000121523.1.83365 WP_000121523.1.83413 WP_000121523.1.83491 WP_000121523.1.83523 WP_000121523.1.8354 WP_000121523.1.83651 WP_000121523.1.83721 WP_000121523.1.83760 WP_000121523.1.83995 WP_000121523.1.84103 WP_000121523.1.84283 WP_000121523.1.84392 WP_000121523.1.8441 WP_000121523.1.84532 WP_000121523.1.84554 WP_000121523.1.84659 WP_000121523.1.84693 WP_000121523.1.84899 WP_000121523.1.8497 WP_000121523.1.85040 WP_000121523.1.85134 WP_000121523.1.85178 WP_000121523.1.85180 WP_000121523.1.85190 WP_000121523.1.8533 WP_000121523.1.8545 WP_000121523.1.85481 WP_000121523.1.85483 WP_000121523.1.85541 WP_000121523.1.8556 WP_000121523.1.85615 WP_000121523.1.85617 WP_000121523.1.85671 WP_000121523.1.85672 WP_000121523.1.85777 WP_000121523.1.85855 WP_000121523.1.85886 WP_000121523.1.85900 WP_000121523.1.85904 WP_000121523.1.85976 WP_000121523.1.86306 WP_000121523.1.86356 WP_000121523.1.86450 WP_000121523.1.86469 WP_000121523.1.86580 WP_000121523.1.86588 WP_000121523.1.86661 WP_000121523.1.8672 WP_000121523.1.8678 WP_000121523.1.86810 WP_000121523.1.8684 WP_000121523.1.86895 WP_000121523.1.86906 WP_000121523.1.87095 WP_000121523.1.87323 WP_000121523.1.8736 WP_000121523.1.87460 WP_000121523.1.87552 WP_000121523.1.87779 WP_000121523.1.87945 WP_000121523.1.88019 WP_000121523.1.88073 WP_000121523.1.88291 WP_000121523.1.88293 WP_000121523.1.8837 WP_000121523.1.88393 WP_000121523.1.88703 WP_000121523.1.88792 WP_000121523.1.88902 WP_000121523.1.8891 WP_000121523.1.88981 WP_000121523.1.89008 WP_000121523.1.89116 WP_000121523.1.89138 WP_000121523.1.89304 WP_000121523.1.89512 WP_000121523.1.89527 WP_000121523.1.89570 WP_000121523.1.89604 WP_000121523.1.89622 WP_000121523.1.89659 WP_000121523.1.89902 WP_000121523.1.8996 WP_000121523.1.90097 WP_000121523.1.90252 WP_000121523.1.90417 WP_000121523.1.90453 WP_000121523.1.90458 WP_000121523.1.90557 WP_000121523.1.90585 WP_000121523.1.90641 WP_000121523.1.90734 WP_000121523.1.91003 WP_000121523.1.91069 WP_000121523.1.91278 WP_000121523.1.9131 WP_000121523.1.91512 WP_000121523.1.91524 WP_000121523.1.91564 WP_000121523.1.91628 WP_000121523.1.91655 WP_000121523.1.91724 WP_000121523.1.91732 WP_000121523.1.91788 WP_000121523.1.92013 WP_000121523.1.92060 WP_000121523.1.92093 WP_000121523.1.92108 WP_000121523.1.92171 WP_000121523.1.92183 WP_000121523.1.92208 WP_000121523.1.92268 WP_000121523.1.92310 WP_000121523.1.92318 WP_000121523.1.92443 WP_000121523.1.92482 WP_000121523.1.92529 WP_000121523.1.92531 WP_000121523.1.92669 WP_000121523.1.92671 WP_000121523.1.92738 WP_000121523.1.93086 WP_000121523.1.93101 WP_000121523.1.93136 WP_000121523.1.93155 WP_000121523.1.93275 WP_000121523.1.93365 WP_000121523.1.93376 WP_000121523.1.93543 WP_000121523.1.93650 WP_000121523.1.93656 WP_000121523.1.93662 WP_000121523.1.937 WP_000121523.1.93705 WP_000121523.1.93804 WP_000121523.1.93994 WP_000121523.1.94072 WP_000121523.1.94162 WP_000121523.1.94168 WP_000121523.1.94198 WP_000121523.1.9432 WP_000121523.1.94354 WP_000121523.1.94380 WP_000121523.1.94458 WP_000121523.1.94565 WP_000121523.1.94584 WP_000121523.1.94674 WP_000121523.1.94796 WP_000121523.1.94959 WP_000121523.1.95051 WP_000121523.1.95085 WP_000121523.1.95121 WP_000121523.1.95282 WP_000121523.1.95546 WP_000121523.1.95630 WP_000121523.1.96139 WP_000121523.1.96317 WP_000121523.1.96343 WP_000121523.1.9644 WP_000121523.1.96469 WP_000121523.1.96497 WP_000121523.1.96500 WP_000121523.1.96555 WP_000121523.1.96563 WP_000121523.1.96732 WP_000121523.1.96771 WP_000121523.1.97015 WP_000121523.1.97145 WP_000121523.1.97190 WP_000121523.1.97318 WP_000121523.1.97369 WP_000121523.1.97597 WP_000121523.1.97613 WP_000121523.1.97620 WP_000121523.1.97727 WP_000121523.1.97732 WP_000121523.1.97736 WP_000121523.1.9775 WP_000121523.1.97846 WP_000121523.1.98006 WP_000121523.1.98019 WP_000121523.1.98022 WP_000121523.1.98110 WP_000121523.1.98146 WP_000121523.1.98219 WP_000121523.1.9841 WP_000121523.1.98495 WP_000121523.1.98531 WP_000121523.1.98577 WP_000121523.1.98676 WP_000121523.1.98677 WP_000121523.1.98760 WP_000121523.1.98843 WP_000121523.1.9898 WP_000121523.1.99072 WP_000121523.1.99098 WP_000121523.1.99184 WP_000121523.1.99267 WP_000121523.1.99276 WP_000121523.1.99657 WP_000121523.1.99660 WP_000121523.1.99712 WP_000121523.1.99813 WP_000121523.1.99889 gi|482905788|ref|YP_007904348.1| gi|378452036|ref|YP_005239396.1| gi|379702480|ref|YP_005244208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]