SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379700487|ref|YP_005242215.1| from Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379700487|ref|YP_005242215.1|
Domain Number 1 Region: 15-113
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.22e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379700487|ref|YP_005242215.1|
Sequence length 115
Comment PTS system N,N'-diacetylchitobiose-specific transporter subunit IIA [Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74]
Sequence
MFDLENVVDNQTAAEELEEVVMGLIINSGQARSLAYGALRKAKEGDFEAAKAMMDQSRIA
LNEAHLVQTKLIEGDQGEGKMKVSLVLVHAQDHLMTSMLARELIAELIELHEKLK
Download sequence
Identical sequences A0A0D6GEI9 A0A0F6B0P8 A0A0F7J7U7 A0A0G2NNY9 A0A0H2WPI3 A0A0H3BR77 A0A0H3NKL5 A0A0L3IS93 A0A0M0Q9C3 A0A0N1TVB1 A0A0R9N386 A0A0T9VMZ3 A0A0T9WG53 A0A0V2F3Q7 A0A1C2ZUM9 A0A1R2Y2R6 A0A1S0ZKJ6 A0A1S1AGF0 A0A1X2RUU1 A0A1X2V5G2 A0A1X2Y419 A0A1Z3Q3F0 A0A221YK46 A0A221Z0V1 A0A265BCN9 A0A267SA17 A0A271CMF4 A0A271D1V4 A0A2C9P0J2 A0A2D1XEZ0 A0A2D1XSQ1 A0A2D3TXE0 A0A2G1PB24 A0A2H9YHB3 A0A2I6M977 A0A2I6MM42 A0A2I6N082 A0A2I6NED9 A0A2I6NRZ5 A0A2K3A5T2 B5F7H9 B5RAZ0 E8XGC1 G4BY52 G5LPN2 G5MJA5 G5NDY3 G5PNY6 G5Q3J5 G5QHD7 G5R108 G5RGG0 G5RW51 G5SCQ5 M7RA91 Q57PX0 Q8ZPU3 S4I3Y8 S5HJT4 V1W8A1 V7II25 V7UDZ1
gi|528819102|ref|YP_008360305.1| gi|378699203|ref|YP_005181160.1| gi|525817201|ref|YP_008247219.1| gi|563653260|ref|YP_008861327.1| gi|452120515|ref|YP_007470763.1| gi|161614281|ref|YP_001588246.1| gi|378449812|ref|YP_005237171.1| gi|549479159|ref|YP_008613099.1| gi|409250376|ref|YP_006886187.1| gi|378988655|ref|YP_005251819.1| gi|194449994|ref|YP_002045322.1| gi|194737684|ref|YP_002114334.1| 272994.SPAB_02026 295319.SPA1530 321314.SC1335 423368.SNSL254_A1428 439843.SeSA_A1411 439851.SeD_A2030 454166.SeAg_B1857 454169.SeHA_C1443 550537.SEN1729 550538.SG1802 554290.SSPA1421 99287.STM1314 gi|62179905|ref|YP_216322.1| gi|549723952|ref|YP_008644142.1| gi|378444744|ref|YP_005232376.1| ABAK02000001|CDS_712552-712899 ABAM02000001|CDS_1853510-1853857 ABAN01000017|CDS_21097-20750 ABAO01000010|CDS_20774-20427 ABEH02000002|CDS_44186-44533 ABEI01000015|CDS_121694-122041 ABEJ01000024|CDS_45891-46238 ABEL01000013|CDS_114127-114474 ABEW01000001|CDS_696751-696404 ABFF01000015|CDS_91604-91951 ABFG01000011|CDS_110838-110491 ABFH02000002|CDS_754119-753772 AE006468|CDS_1393619-1393966 AE017220|CDS_1432282-1432629 AM933172|CDS_1835718-1835371 AM933173|CDS_1875529-1875182 CP000026|CDS_1605221-1604874 CP000886|CDS_1728617-1728270 CP001113|CDS_1395589-1395936 CP001120|CDS_1398664-1399011 CP001127|CDS_1360291-1360638 CP001138|CDS_1819661-1819314 CP001144|CDS_1964008-1963661 CP001363|CDS_1403595-1403942 FM200053|CDS_1600402-1600055 FN424405|CDS_1390131-1390478 NZ_ACBF01000004|CDS_62789-62442 gi|525838445|ref|YP_008255490.1| gi|529219552|ref|YP_008380555.1| gi|550900683|ref|YP_008669775.1| gi|56413700|ref|YP_150775.1| gi|537436433|ref|YP_008480810.1| gi|526220009|ref|YP_008265513.1| gi|378983872|ref|YP_005247027.1| gi|205352961|ref|YP_002226762.1| gi|198245752|ref|YP_002215810.1| gi|379700487|ref|YP_005242215.1| gi|525947510|ref|YP_008308907.1| gi|482903124|ref|YP_007901684.1| gi|194444735|ref|YP_002040574.1| gi|16764665|ref|NP_460280.1| gi|197249987|ref|YP_002146721.1| gi|197362623|ref|YP_002142260.1| gi|386591167|ref|YP_006087567.1| gi|383496028|ref|YP_005396717.1| gi|378954861|ref|YP_005212348.1| gi|207857177|ref|YP_002243828.1| gi|538361896|ref|YP_008505181.1| NP_460280.1.58477 WP_000459883.1.100002 WP_000459883.1.100007 WP_000459883.1.100010 WP_000459883.1.100017 WP_000459883.1.100031 WP_000459883.1.100077 WP_000459883.1.100115 WP_000459883.1.100129 WP_000459883.1.10013 WP_000459883.1.100137 WP_000459883.1.100149 WP_000459883.1.100191 WP_000459883.1.1002 WP_000459883.1.100234 WP_000459883.1.100258 WP_000459883.1.100266 WP_000459883.1.100288 WP_000459883.1.100376 WP_000459883.1.100392 WP_000459883.1.100412 WP_000459883.1.100424 WP_000459883.1.100432 WP_000459883.1.100436 WP_000459883.1.100438 WP_000459883.1.100457 WP_000459883.1.100472 WP_000459883.1.100484 WP_000459883.1.100488 WP_000459883.1.100502 WP_000459883.1.100519 WP_000459883.1.100521 WP_000459883.1.100541 WP_000459883.1.100557 WP_000459883.1.100584 WP_000459883.1.100589 WP_000459883.1.100597 WP_000459883.1.100605 WP_000459883.1.100642 WP_000459883.1.10065 WP_000459883.1.100650 WP_000459883.1.100707 WP_000459883.1.100711 WP_000459883.1.100714 WP_000459883.1.100721 WP_000459883.1.100730 WP_000459883.1.10074 WP_000459883.1.100750 WP_000459883.1.10076 WP_000459883.1.100773 WP_000459883.1.100776 WP_000459883.1.100781 WP_000459883.1.100790 WP_000459883.1.100793 WP_000459883.1.10081 WP_000459883.1.100814 WP_000459883.1.100857 WP_000459883.1.100865 WP_000459883.1.100869 WP_000459883.1.100870 WP_000459883.1.100871 WP_000459883.1.100882 WP_000459883.1.100886 WP_000459883.1.100895 WP_000459883.1.100932 WP_000459883.1.100944 WP_000459883.1.100948 WP_000459883.1.101007 WP_000459883.1.101020 WP_000459883.1.101042 WP_000459883.1.101074 WP_000459883.1.101078 WP_000459883.1.101091 WP_000459883.1.101094 WP_000459883.1.101111 WP_000459883.1.101112 WP_000459883.1.101123 WP_000459883.1.101126 WP_000459883.1.101147 WP_000459883.1.101180 WP_000459883.1.101185 WP_000459883.1.101199 WP_000459883.1.101239 WP_000459883.1.101259 WP_000459883.1.101284 WP_000459883.1.101291 WP_000459883.1.1013 WP_000459883.1.101320 WP_000459883.1.101353 WP_000459883.1.101386 WP_000459883.1.101404 WP_000459883.1.101420 WP_000459883.1.101425 WP_000459883.1.101454 WP_000459883.1.101473 WP_000459883.1.101519 WP_000459883.1.101520 WP_000459883.1.101541 WP_000459883.1.101589 WP_000459883.1.101609 WP_000459883.1.101612 WP_000459883.1.101634 WP_000459883.1.101636 WP_000459883.1.101639 WP_000459883.1.10164 WP_000459883.1.101666 WP_000459883.1.101674 WP_000459883.1.101707 WP_000459883.1.101724 WP_000459883.1.101734 WP_000459883.1.101741 WP_000459883.1.101744 WP_000459883.1.101759 WP_000459883.1.10177 WP_000459883.1.101776 WP_000459883.1.101815 WP_000459883.1.101832 WP_000459883.1.101839 WP_000459883.1.101841 WP_000459883.1.101868 WP_000459883.1.101878 WP_000459883.1.101904 WP_000459883.1.10191 WP_000459883.1.101917 WP_000459883.1.101927 WP_000459883.1.101949 WP_000459883.1.101953 WP_000459883.1.101975 WP_000459883.1.102009 WP_000459883.1.102103 WP_000459883.1.102111 WP_000459883.1.10220 WP_000459883.1.10231 WP_000459883.1.10237 WP_000459883.1.10266 WP_000459883.1.10276 WP_000459883.1.10293 WP_000459883.1.10300 WP_000459883.1.10310 WP_000459883.1.10394 WP_000459883.1.10429 WP_000459883.1.10439 WP_000459883.1.10465 WP_000459883.1.10498 WP_000459883.1.10507 WP_000459883.1.10521 WP_000459883.1.10562 WP_000459883.1.10566 WP_000459883.1.10568 WP_000459883.1.106 WP_000459883.1.10631 WP_000459883.1.10675 WP_000459883.1.10678 WP_000459883.1.10711 WP_000459883.1.10720 WP_000459883.1.10753 WP_000459883.1.10755 WP_000459883.1.10797 WP_000459883.1.10868 WP_000459883.1.10898 WP_000459883.1.10992 WP_000459883.1.11000 WP_000459883.1.11024 WP_000459883.1.11031 WP_000459883.1.11041 WP_000459883.1.11098 WP_000459883.1.1110 WP_000459883.1.11119 WP_000459883.1.11156 WP_000459883.1.11168 WP_000459883.1.11190 WP_000459883.1.11213 WP_000459883.1.11216 WP_000459883.1.11254 WP_000459883.1.11295 WP_000459883.1.113 WP_000459883.1.11304 WP_000459883.1.1135 WP_000459883.1.11362 WP_000459883.1.11369 WP_000459883.1.11444 WP_000459883.1.11455 WP_000459883.1.11458 WP_000459883.1.11479 WP_000459883.1.1150 WP_000459883.1.11511 WP_000459883.1.11518 WP_000459883.1.11526 WP_000459883.1.11528 WP_000459883.1.11532 WP_000459883.1.11543 WP_000459883.1.1156 WP_000459883.1.11565 WP_000459883.1.11588 WP_000459883.1.11603 WP_000459883.1.11621 WP_000459883.1.11677 WP_000459883.1.11681 WP_000459883.1.11687 WP_000459883.1.1169 WP_000459883.1.11735 WP_000459883.1.1174 WP_000459883.1.11763 WP_000459883.1.11772 WP_000459883.1.11810 WP_000459883.1.11824 WP_000459883.1.11834 WP_000459883.1.11841 WP_000459883.1.11865 WP_000459883.1.11868 WP_000459883.1.11875 WP_000459883.1.11897 WP_000459883.1.11900 WP_000459883.1.11936 WP_000459883.1.11938 WP_000459883.1.11964 WP_000459883.1.11978 WP_000459883.1.12007 WP_000459883.1.12017 WP_000459883.1.12025 WP_000459883.1.12027 WP_000459883.1.12047 WP_000459883.1.12059 WP_000459883.1.12063 WP_000459883.1.12106 WP_000459883.1.12144 WP_000459883.1.1215 WP_000459883.1.12159 WP_000459883.1.12168 WP_000459883.1.12210 WP_000459883.1.12244 WP_000459883.1.12280 WP_000459883.1.12282 WP_000459883.1.12308 WP_000459883.1.12340 WP_000459883.1.12351 WP_000459883.1.12370 WP_000459883.1.12374 WP_000459883.1.1239 WP_000459883.1.12396 WP_000459883.1.12397 WP_000459883.1.12456 WP_000459883.1.1246 WP_000459883.1.12472 WP_000459883.1.12484 WP_000459883.1.12485 WP_000459883.1.1250 WP_000459883.1.12546 WP_000459883.1.12568 WP_000459883.1.12569 WP_000459883.1.12584 WP_000459883.1.12585 WP_000459883.1.1264 WP_000459883.1.12650 WP_000459883.1.12696 WP_000459883.1.12701 WP_000459883.1.12718 WP_000459883.1.12728 WP_000459883.1.12864 WP_000459883.1.12865 WP_000459883.1.12877 WP_000459883.1.12879 WP_000459883.1.12936 WP_000459883.1.1299 WP_000459883.1.12995 WP_000459883.1.1300 WP_000459883.1.13027 WP_000459883.1.13076 WP_000459883.1.13101 WP_000459883.1.13102 WP_000459883.1.13106 WP_000459883.1.13130 WP_000459883.1.13207 WP_000459883.1.13247 WP_000459883.1.1326 WP_000459883.1.13262 WP_000459883.1.13274 WP_000459883.1.13311 WP_000459883.1.13334 WP_000459883.1.13367 WP_000459883.1.13391 WP_000459883.1.13414 WP_000459883.1.13429 WP_000459883.1.13446 WP_000459883.1.1346 WP_000459883.1.13488 WP_000459883.1.13509 WP_000459883.1.13528 WP_000459883.1.13543 WP_000459883.1.13573 WP_000459883.1.13602 WP_000459883.1.13625 WP_000459883.1.13661 WP_000459883.1.13669 WP_000459883.1.13677 WP_000459883.1.13691 WP_000459883.1.13741 WP_000459883.1.13750 WP_000459883.1.13764 WP_000459883.1.13799 WP_000459883.1.13827 WP_000459883.1.13829 WP_000459883.1.13848 WP_000459883.1.13857 WP_000459883.1.1387 WP_000459883.1.13908 WP_000459883.1.13932 WP_000459883.1.13967 WP_000459883.1.13968 WP_000459883.1.14001 WP_000459883.1.14011 WP_000459883.1.14041 WP_000459883.1.14050 WP_000459883.1.14056 WP_000459883.1.14111 WP_000459883.1.1412 WP_000459883.1.14151 WP_000459883.1.14212 WP_000459883.1.14239 WP_000459883.1.14286 WP_000459883.1.14296 WP_000459883.1.14320 WP_000459883.1.14369 WP_000459883.1.14379 WP_000459883.1.1440 WP_000459883.1.14406 WP_000459883.1.14410 WP_000459883.1.14436 WP_000459883.1.14446 WP_000459883.1.14458 WP_000459883.1.14466 WP_000459883.1.14495 WP_000459883.1.14505 WP_000459883.1.14516 WP_000459883.1.14519 WP_000459883.1.14524 WP_000459883.1.14528 WP_000459883.1.14554 WP_000459883.1.146 WP_000459883.1.14618 WP_000459883.1.14688 WP_000459883.1.14708 WP_000459883.1.14725 WP_000459883.1.14737 WP_000459883.1.14789 WP_000459883.1.14793 WP_000459883.1.14808 WP_000459883.1.14819 WP_000459883.1.14852 WP_000459883.1.14876 WP_000459883.1.14884 WP_000459883.1.1489 WP_000459883.1.14913 WP_000459883.1.14917 WP_000459883.1.14927 WP_000459883.1.14932 WP_000459883.1.14936 WP_000459883.1.14964 WP_000459883.1.15011 WP_000459883.1.15046 WP_000459883.1.15054 WP_000459883.1.15055 WP_000459883.1.15059 WP_000459883.1.15067 WP_000459883.1.15079 WP_000459883.1.15100 WP_000459883.1.15102 WP_000459883.1.15124 WP_000459883.1.15214 WP_000459883.1.15223 WP_000459883.1.15226 WP_000459883.1.15276 WP_000459883.1.15316 WP_000459883.1.15318 WP_000459883.1.15353 WP_000459883.1.15369 WP_000459883.1.1540 WP_000459883.1.15468 WP_000459883.1.15479 WP_000459883.1.15483 WP_000459883.1.15508 WP_000459883.1.1551 WP_000459883.1.15585 WP_000459883.1.15586 WP_000459883.1.15612 WP_000459883.1.15616 WP_000459883.1.15625 WP_000459883.1.15627 WP_000459883.1.1568 WP_000459883.1.15708 WP_000459883.1.15775 WP_000459883.1.15777 WP_000459883.1.15784 WP_000459883.1.15795 WP_000459883.1.158 WP_000459883.1.15830 WP_000459883.1.15835 WP_000459883.1.15862 WP_000459883.1.15909 WP_000459883.1.15910 WP_000459883.1.1592 WP_000459883.1.15922 WP_000459883.1.15938 WP_000459883.1.15978 WP_000459883.1.15986 WP_000459883.1.15995 WP_000459883.1.16000 WP_000459883.1.16004 WP_000459883.1.16006 WP_000459883.1.1601 WP_000459883.1.16028 WP_000459883.1.16032 WP_000459883.1.16047 WP_000459883.1.16052 WP_000459883.1.16062 WP_000459883.1.16063 WP_000459883.1.16103 WP_000459883.1.1611 WP_000459883.1.16125 WP_000459883.1.16158 WP_000459883.1.16172 WP_000459883.1.16201 WP_000459883.1.16226 WP_000459883.1.16233 WP_000459883.1.16273 WP_000459883.1.16284 WP_000459883.1.16328 WP_000459883.1.16331 WP_000459883.1.1635 WP_000459883.1.16361 WP_000459883.1.16363 WP_000459883.1.16365 WP_000459883.1.16366 WP_000459883.1.16394 WP_000459883.1.16453 WP_000459883.1.16468 WP_000459883.1.16474 WP_000459883.1.16508 WP_000459883.1.16525 WP_000459883.1.16551 WP_000459883.1.16565 WP_000459883.1.16581 WP_000459883.1.16614 WP_000459883.1.16650 WP_000459883.1.16656 WP_000459883.1.1668 WP_000459883.1.16686 WP_000459883.1.16691 WP_000459883.1.167 WP_000459883.1.16710 WP_000459883.1.16729 WP_000459883.1.16732 WP_000459883.1.16735 WP_000459883.1.16736 WP_000459883.1.16786 WP_000459883.1.16804 WP_000459883.1.16817 WP_000459883.1.16819 WP_000459883.1.16826 WP_000459883.1.16846 WP_000459883.1.16855 WP_000459883.1.16858 WP_000459883.1.16873 WP_000459883.1.1689 WP_000459883.1.16896 WP_000459883.1.16903 WP_000459883.1.16910 WP_000459883.1.16916 WP_000459883.1.16941 WP_000459883.1.16942 WP_000459883.1.16944 WP_000459883.1.16949 WP_000459883.1.16965 WP_000459883.1.16972 WP_000459883.1.16998 WP_000459883.1.1700 WP_000459883.1.17031 WP_000459883.1.17060 WP_000459883.1.17093 WP_000459883.1.17096 WP_000459883.1.17098 WP_000459883.1.17105 WP_000459883.1.17188 WP_000459883.1.17270 WP_000459883.1.17285 WP_000459883.1.17307 WP_000459883.1.1733 WP_000459883.1.1737 WP_000459883.1.17390 WP_000459883.1.174 WP_000459883.1.17439 WP_000459883.1.17447 WP_000459883.1.17480 WP_000459883.1.17482 WP_000459883.1.1749 WP_000459883.1.17504 WP_000459883.1.17525 WP_000459883.1.17546 WP_000459883.1.17560 WP_000459883.1.1757 WP_000459883.1.17583 WP_000459883.1.17629 WP_000459883.1.17693 WP_000459883.1.17702 WP_000459883.1.17703 WP_000459883.1.17705 WP_000459883.1.17732 WP_000459883.1.17743 WP_000459883.1.17747 WP_000459883.1.17755 WP_000459883.1.17758 WP_000459883.1.17865 WP_000459883.1.17886 WP_000459883.1.17891 WP_000459883.1.17901 WP_000459883.1.17914 WP_000459883.1.17919 WP_000459883.1.17936 WP_000459883.1.17949 WP_000459883.1.1798 WP_000459883.1.17991 WP_000459883.1.18019 WP_000459883.1.18022 WP_000459883.1.18056 WP_000459883.1.18061 WP_000459883.1.18089 WP_000459883.1.18092 WP_000459883.1.18103 WP_000459883.1.18109 WP_000459883.1.18111 WP_000459883.1.18122 WP_000459883.1.1814 WP_000459883.1.18149 WP_000459883.1.18163 WP_000459883.1.18177 WP_000459883.1.18178 WP_000459883.1.1818 WP_000459883.1.18192 WP_000459883.1.18249 WP_000459883.1.1825 WP_000459883.1.18254 WP_000459883.1.18267 WP_000459883.1.18277 WP_000459883.1.18281 WP_000459883.1.18282 WP_000459883.1.18355 WP_000459883.1.18365 WP_000459883.1.18384 WP_000459883.1.18426 WP_000459883.1.18441 WP_000459883.1.18445 WP_000459883.1.18468 WP_000459883.1.18485 WP_000459883.1.18489 WP_000459883.1.18607 WP_000459883.1.18641 WP_000459883.1.18686 WP_000459883.1.18692 WP_000459883.1.18705 WP_000459883.1.18715 WP_000459883.1.18737 WP_000459883.1.18776 WP_000459883.1.18822 WP_000459883.1.18847 WP_000459883.1.18881 WP_000459883.1.18886 WP_000459883.1.18895 WP_000459883.1.18919 WP_000459883.1.18940 WP_000459883.1.18949 WP_000459883.1.1895 WP_000459883.1.1897 WP_000459883.1.18972 WP_000459883.1.19030 WP_000459883.1.19038 WP_000459883.1.19053 WP_000459883.1.19064 WP_000459883.1.19093 WP_000459883.1.19163 WP_000459883.1.19174 WP_000459883.1.19240 WP_000459883.1.19273 WP_000459883.1.19291 WP_000459883.1.19320 WP_000459883.1.19340 WP_000459883.1.19357 WP_000459883.1.19373 WP_000459883.1.1939 WP_000459883.1.19405 WP_000459883.1.19433 WP_000459883.1.19458 WP_000459883.1.19460 WP_000459883.1.19461 WP_000459883.1.19469 WP_000459883.1.1954 WP_000459883.1.1955 WP_000459883.1.19588 WP_000459883.1.19614 WP_000459883.1.19616 WP_000459883.1.19642 WP_000459883.1.19656 WP_000459883.1.19660 WP_000459883.1.1968 WP_000459883.1.19683 WP_000459883.1.19702 WP_000459883.1.19706 WP_000459883.1.19723 WP_000459883.1.19724 WP_000459883.1.19740 WP_000459883.1.19749 WP_000459883.1.19784 WP_000459883.1.19793 WP_000459883.1.19802 WP_000459883.1.19809 WP_000459883.1.19834 WP_000459883.1.19851 WP_000459883.1.19863 WP_000459883.1.19867 WP_000459883.1.19882 WP_000459883.1.19884 WP_000459883.1.1990 WP_000459883.1.19938 WP_000459883.1.19967 WP_000459883.1.19970 WP_000459883.1.19975 WP_000459883.1.1998 WP_000459883.1.19987 WP_000459883.1.20 WP_000459883.1.20023 WP_000459883.1.20034 WP_000459883.1.20081 WP_000459883.1.20086 WP_000459883.1.20089 WP_000459883.1.20091 WP_000459883.1.2010 WP_000459883.1.20119 WP_000459883.1.20212 WP_000459883.1.20218 WP_000459883.1.2026 WP_000459883.1.20261 WP_000459883.1.20266 WP_000459883.1.20271 WP_000459883.1.20330 WP_000459883.1.20349 WP_000459883.1.2036 WP_000459883.1.20362 WP_000459883.1.20364 WP_000459883.1.20376 WP_000459883.1.20391 WP_000459883.1.2041 WP_000459883.1.20415 WP_000459883.1.20418 WP_000459883.1.20425 WP_000459883.1.20437 WP_000459883.1.20443 WP_000459883.1.20446 WP_000459883.1.2047 WP_000459883.1.20488 WP_000459883.1.20503 WP_000459883.1.20525 WP_000459883.1.2054 WP_000459883.1.20553 WP_000459883.1.20564 WP_000459883.1.20614 WP_000459883.1.20626 WP_000459883.1.20631 WP_000459883.1.20646 WP_000459883.1.20695 WP_000459883.1.20700 WP_000459883.1.20721 WP_000459883.1.20760 WP_000459883.1.20767 WP_000459883.1.20787 WP_000459883.1.20789 WP_000459883.1.20795 WP_000459883.1.20810 WP_000459883.1.20839 WP_000459883.1.20862 WP_000459883.1.20886 WP_000459883.1.20900 WP_000459883.1.20908 WP_000459883.1.2091 WP_000459883.1.21049 WP_000459883.1.2107 WP_000459883.1.21075 WP_000459883.1.21079 WP_000459883.1.21089 WP_000459883.1.21103 WP_000459883.1.21136 WP_000459883.1.21146 WP_000459883.1.2116 WP_000459883.1.21181 WP_000459883.1.21194 WP_000459883.1.21202 WP_000459883.1.21241 WP_000459883.1.21245 WP_000459883.1.21246 WP_000459883.1.21260 WP_000459883.1.21269 WP_000459883.1.21286 WP_000459883.1.2130 WP_000459883.1.21309 WP_000459883.1.21326 WP_000459883.1.21332 WP_000459883.1.21351 WP_000459883.1.21362 WP_000459883.1.2139 WP_000459883.1.21399 WP_000459883.1.21400 WP_000459883.1.21404 WP_000459883.1.21423 WP_000459883.1.21443 WP_000459883.1.21453 WP_000459883.1.2146 WP_000459883.1.21473 WP_000459883.1.21497 WP_000459883.1.21499 WP_000459883.1.21534 WP_000459883.1.21548 WP_000459883.1.21603 WP_000459883.1.21616 WP_000459883.1.21681 WP_000459883.1.21692 WP_000459883.1.21715 WP_000459883.1.21728 WP_000459883.1.21730 WP_000459883.1.21751 WP_000459883.1.21757 WP_000459883.1.21792 WP_000459883.1.21825 WP_000459883.1.21845 WP_000459883.1.21877 WP_000459883.1.21886 WP_000459883.1.21909 WP_000459883.1.21910 WP_000459883.1.21940 WP_000459883.1.21950 WP_000459883.1.21981 WP_000459883.1.21991 WP_000459883.1.22019 WP_000459883.1.22024 WP_000459883.1.2205 WP_000459883.1.22051 WP_000459883.1.22062 WP_000459883.1.22067 WP_000459883.1.22069 WP_000459883.1.22096 WP_000459883.1.22117 WP_000459883.1.22136 WP_000459883.1.22158 WP_000459883.1.22162 WP_000459883.1.22169 WP_000459883.1.22205 WP_000459883.1.2221 WP_000459883.1.22235 WP_000459883.1.2224 WP_000459883.1.22240 WP_000459883.1.22270 WP_000459883.1.22296 WP_000459883.1.22323 WP_000459883.1.22337 WP_000459883.1.22346 WP_000459883.1.2235 WP_000459883.1.22379 WP_000459883.1.22388 WP_000459883.1.22427 WP_000459883.1.22449 WP_000459883.1.22451 WP_000459883.1.22454 WP_000459883.1.2246 WP_000459883.1.22460 WP_000459883.1.22485 WP_000459883.1.22514 WP_000459883.1.22537 WP_000459883.1.22565 WP_000459883.1.22566 WP_000459883.1.22575 WP_000459883.1.22582 WP_000459883.1.22590 WP_000459883.1.22595 WP_000459883.1.22605 WP_000459883.1.22620 WP_000459883.1.22623 WP_000459883.1.22676 WP_000459883.1.22692 WP_000459883.1.22758 WP_000459883.1.22760 WP_000459883.1.2283 WP_000459883.1.22845 WP_000459883.1.22855 WP_000459883.1.22857 WP_000459883.1.22864 WP_000459883.1.22870 WP_000459883.1.22880 WP_000459883.1.22902 WP_000459883.1.22947 WP_000459883.1.22966 WP_000459883.1.22979 WP_000459883.1.23053 WP_000459883.1.23080 WP_000459883.1.23102 WP_000459883.1.23114 WP_000459883.1.2314 WP_000459883.1.23148 WP_000459883.1.23155 WP_000459883.1.23169 WP_000459883.1.23172 WP_000459883.1.23175 WP_000459883.1.23192 WP_000459883.1.23201 WP_000459883.1.2324 WP_000459883.1.23246 WP_000459883.1.23258 WP_000459883.1.23259 WP_000459883.1.23274 WP_000459883.1.23279 WP_000459883.1.23309 WP_000459883.1.23311 WP_000459883.1.23329 WP_000459883.1.23343 WP_000459883.1.23379 WP_000459883.1.23409 WP_000459883.1.2342 WP_000459883.1.23442 WP_000459883.1.23444 WP_000459883.1.23460 WP_000459883.1.23466 WP_000459883.1.23472 WP_000459883.1.23482 WP_000459883.1.235 WP_000459883.1.23500 WP_000459883.1.23503 WP_000459883.1.23509 WP_000459883.1.23513 WP_000459883.1.23529 WP_000459883.1.2358 WP_000459883.1.23621 WP_000459883.1.23631 WP_000459883.1.23634 WP_000459883.1.23639 WP_000459883.1.2364 WP_000459883.1.23643 WP_000459883.1.23646 WP_000459883.1.23670 WP_000459883.1.23675 WP_000459883.1.23685 WP_000459883.1.237 WP_000459883.1.23707 WP_000459883.1.23720 WP_000459883.1.23736 WP_000459883.1.23746 WP_000459883.1.23755 WP_000459883.1.2376 WP_000459883.1.2380 WP_000459883.1.23819 WP_000459883.1.23932 WP_000459883.1.23959 WP_000459883.1.24017 WP_000459883.1.24082 WP_000459883.1.24145 WP_000459883.1.2415 WP_000459883.1.24163 WP_000459883.1.24206 WP_000459883.1.24214 WP_000459883.1.24250 WP_000459883.1.24259 WP_000459883.1.24297 WP_000459883.1.24303 WP_000459883.1.24308 WP_000459883.1.24325 WP_000459883.1.24361 WP_000459883.1.24376 WP_000459883.1.24392 WP_000459883.1.24394 WP_000459883.1.24408 WP_000459883.1.24409 WP_000459883.1.24412 WP_000459883.1.24419 WP_000459883.1.24433 WP_000459883.1.24444 WP_000459883.1.24450 WP_000459883.1.24476 WP_000459883.1.24494 WP_000459883.1.24521 WP_000459883.1.24555 WP_000459883.1.24567 WP_000459883.1.24578 WP_000459883.1.2467 WP_000459883.1.24673 WP_000459883.1.24686 WP_000459883.1.24689 WP_000459883.1.24696 WP_000459883.1.24723 WP_000459883.1.24727 WP_000459883.1.24737 WP_000459883.1.24779 WP_000459883.1.24803 WP_000459883.1.24837 WP_000459883.1.24839 WP_000459883.1.24901 WP_000459883.1.24944 WP_000459883.1.24995 WP_000459883.1.25008 WP_000459883.1.25015 WP_000459883.1.25036 WP_000459883.1.25064 WP_000459883.1.25072 WP_000459883.1.25119 WP_000459883.1.25130 WP_000459883.1.25159 WP_000459883.1.25175 WP_000459883.1.25205 WP_000459883.1.25206 WP_000459883.1.25217 WP_000459883.1.25229 WP_000459883.1.2525 WP_000459883.1.25297 WP_000459883.1.25354 WP_000459883.1.25397 WP_000459883.1.25405 WP_000459883.1.25421 WP_000459883.1.25426 WP_000459883.1.25454 WP_000459883.1.25493 WP_000459883.1.25498 WP_000459883.1.25514 WP_000459883.1.2554 WP_000459883.1.25546 WP_000459883.1.25564 WP_000459883.1.25596 WP_000459883.1.25618 WP_000459883.1.25668 WP_000459883.1.2568 WP_000459883.1.25690 WP_000459883.1.2570 WP_000459883.1.25700 WP_000459883.1.25703 WP_000459883.1.25708 WP_000459883.1.25709 WP_000459883.1.25722 WP_000459883.1.25740 WP_000459883.1.25780 WP_000459883.1.25793 WP_000459883.1.25809 WP_000459883.1.2581 WP_000459883.1.25814 WP_000459883.1.25825 WP_000459883.1.25846 WP_000459883.1.25928 WP_000459883.1.25932 WP_000459883.1.25944 WP_000459883.1.25951 WP_000459883.1.25988 WP_000459883.1.26030 WP_000459883.1.26034 WP_000459883.1.26075 WP_000459883.1.26083 WP_000459883.1.26122 WP_000459883.1.26123 WP_000459883.1.26194 WP_000459883.1.26213 WP_000459883.1.26269 WP_000459883.1.26282 WP_000459883.1.26311 WP_000459883.1.26319 WP_000459883.1.2634 WP_000459883.1.26363 WP_000459883.1.26384 WP_000459883.1.26426 WP_000459883.1.26429 WP_000459883.1.26440 WP_000459883.1.26441 WP_000459883.1.26493 WP_000459883.1.26512 WP_000459883.1.26532 WP_000459883.1.26551 WP_000459883.1.26563 WP_000459883.1.26567 WP_000459883.1.26576 WP_000459883.1.26582 WP_000459883.1.26587 WP_000459883.1.2660 WP_000459883.1.2667 WP_000459883.1.26687 WP_000459883.1.2672 WP_000459883.1.26741 WP_000459883.1.26750 WP_000459883.1.26758 WP_000459883.1.26787 WP_000459883.1.26794 WP_000459883.1.26833 WP_000459883.1.26856 WP_000459883.1.26882 WP_000459883.1.26883 WP_000459883.1.26919 WP_000459883.1.26924 WP_000459883.1.26936 WP_000459883.1.26980 WP_000459883.1.27010 WP_000459883.1.27051 WP_000459883.1.27055 WP_000459883.1.27072 WP_000459883.1.27084 WP_000459883.1.27122 WP_000459883.1.27169 WP_000459883.1.27173 WP_000459883.1.272 WP_000459883.1.27206 WP_000459883.1.27223 WP_000459883.1.2723 WP_000459883.1.27255 WP_000459883.1.27272 WP_000459883.1.27279 WP_000459883.1.27314 WP_000459883.1.27342 WP_000459883.1.27383 WP_000459883.1.27419 WP_000459883.1.27423 WP_000459883.1.27452 WP_000459883.1.27513 WP_000459883.1.27522 WP_000459883.1.27523 WP_000459883.1.27535 WP_000459883.1.27544 WP_000459883.1.27547 WP_000459883.1.27556 WP_000459883.1.27561 WP_000459883.1.27616 WP_000459883.1.2763 WP_000459883.1.27632 WP_000459883.1.27638 WP_000459883.1.27655 WP_000459883.1.27658 WP_000459883.1.27665 WP_000459883.1.27679 WP_000459883.1.27707 WP_000459883.1.27713 WP_000459883.1.27755 WP_000459883.1.27761 WP_000459883.1.2777 WP_000459883.1.27776 WP_000459883.1.27798 WP_000459883.1.27800 WP_000459883.1.27815 WP_000459883.1.27833 WP_000459883.1.27857 WP_000459883.1.27883 WP_000459883.1.27969 WP_000459883.1.27977 WP_000459883.1.27995 WP_000459883.1.27997 WP_000459883.1.28002 WP_000459883.1.28032 WP_000459883.1.28037 WP_000459883.1.28056 WP_000459883.1.2806 WP_000459883.1.28073 WP_000459883.1.28094 WP_000459883.1.28116 WP_000459883.1.28126 WP_000459883.1.28139 WP_000459883.1.28170 WP_000459883.1.28174 WP_000459883.1.28200 WP_000459883.1.28225 WP_000459883.1.28232 WP_000459883.1.28233 WP_000459883.1.28235 WP_000459883.1.2825 WP_000459883.1.28267 WP_000459883.1.2829 WP_000459883.1.28301 WP_000459883.1.28302 WP_000459883.1.28303 WP_000459883.1.2835 WP_000459883.1.28370 WP_000459883.1.28393 WP_000459883.1.28462 WP_000459883.1.28504 WP_000459883.1.2853 WP_000459883.1.28538 WP_000459883.1.28570 WP_000459883.1.28575 WP_000459883.1.28612 WP_000459883.1.28620 WP_000459883.1.28625 WP_000459883.1.28655 WP_000459883.1.28673 WP_000459883.1.28694 WP_000459883.1.287 WP_000459883.1.28733 WP_000459883.1.28773 WP_000459883.1.28775 WP_000459883.1.28776 WP_000459883.1.2879 WP_000459883.1.28811 WP_000459883.1.28830 WP_000459883.1.2890 WP_000459883.1.28902 WP_000459883.1.28921 WP_000459883.1.28938 WP_000459883.1.28946 WP_000459883.1.28948 WP_000459883.1.28963 WP_000459883.1.28977 WP_000459883.1.29006 WP_000459883.1.29010 WP_000459883.1.29099 WP_000459883.1.2910 WP_000459883.1.29113 WP_000459883.1.29130 WP_000459883.1.29168 WP_000459883.1.29174 WP_000459883.1.29218 WP_000459883.1.2924 WP_000459883.1.29255 WP_000459883.1.29265 WP_000459883.1.29274 WP_000459883.1.2932 WP_000459883.1.29349 WP_000459883.1.29379 WP_000459883.1.29422 WP_000459883.1.29436 WP_000459883.1.29454 WP_000459883.1.29509 WP_000459883.1.29530 WP_000459883.1.29576 WP_000459883.1.29588 WP_000459883.1.29593 WP_000459883.1.29601 WP_000459883.1.29606 WP_000459883.1.29615 WP_000459883.1.29619 WP_000459883.1.29682 WP_000459883.1.29704 WP_000459883.1.29711 WP_000459883.1.29732 WP_000459883.1.29768 WP_000459883.1.29774 WP_000459883.1.29775 WP_000459883.1.29827 WP_000459883.1.2984 WP_000459883.1.29845 WP_000459883.1.29898 WP_000459883.1.29923 WP_000459883.1.29924 WP_000459883.1.29969 WP_000459883.1.29990 WP_000459883.1.30006 WP_000459883.1.30018 WP_000459883.1.30022 WP_000459883.1.30027 WP_000459883.1.3005 WP_000459883.1.30059 WP_000459883.1.30093 WP_000459883.1.30165 WP_000459883.1.3017 WP_000459883.1.30170 WP_000459883.1.30179 WP_000459883.1.30180 WP_000459883.1.30195 WP_000459883.1.30202 WP_000459883.1.30210 WP_000459883.1.30213 WP_000459883.1.30225 WP_000459883.1.30238 WP_000459883.1.30246 WP_000459883.1.30278 WP_000459883.1.30331 WP_000459883.1.30356 WP_000459883.1.30386 WP_000459883.1.30389 WP_000459883.1.30425 WP_000459883.1.30437 WP_000459883.1.30469 WP_000459883.1.30492 WP_000459883.1.30505 WP_000459883.1.30507 WP_000459883.1.30535 WP_000459883.1.30547 WP_000459883.1.30548 WP_000459883.1.30555 WP_000459883.1.30573 WP_000459883.1.30589 WP_000459883.1.30602 WP_000459883.1.30619 WP_000459883.1.30627 WP_000459883.1.30635 WP_000459883.1.3066 WP_000459883.1.3067 WP_000459883.1.3068 WP_000459883.1.30696 WP_000459883.1.30752 WP_000459883.1.3076 WP_000459883.1.30794 WP_000459883.1.3080 WP_000459883.1.30802 WP_000459883.1.30803 WP_000459883.1.30819 WP_000459883.1.30823 WP_000459883.1.30833 WP_000459883.1.30835 WP_000459883.1.3089 WP_000459883.1.30909 WP_000459883.1.30934 WP_000459883.1.3095 WP_000459883.1.30951 WP_000459883.1.30968 WP_000459883.1.30972 WP_000459883.1.31 WP_000459883.1.31001 WP_000459883.1.31011 WP_000459883.1.31042 WP_000459883.1.31069 WP_000459883.1.31086 WP_000459883.1.31092 WP_000459883.1.31107 WP_000459883.1.31122 WP_000459883.1.3113 WP_000459883.1.3114 WP_000459883.1.31155 WP_000459883.1.31156 WP_000459883.1.31167 WP_000459883.1.31171 WP_000459883.1.31185 WP_000459883.1.3119 WP_000459883.1.31190 WP_000459883.1.31195 WP_000459883.1.31196 WP_000459883.1.31198 WP_000459883.1.31210 WP_000459883.1.31214 WP_000459883.1.31219 WP_000459883.1.31222 WP_000459883.1.3124 WP_000459883.1.31251 WP_000459883.1.31262 WP_000459883.1.3127 WP_000459883.1.31272 WP_000459883.1.31281 WP_000459883.1.31335 WP_000459883.1.31362 WP_000459883.1.31435 WP_000459883.1.31451 WP_000459883.1.31476 WP_000459883.1.31504 WP_000459883.1.31515 WP_000459883.1.31546 WP_000459883.1.31578 WP_000459883.1.31585 WP_000459883.1.31658 WP_000459883.1.31665 WP_000459883.1.3167 WP_000459883.1.3170 WP_000459883.1.31720 WP_000459883.1.31725 WP_000459883.1.31762 WP_000459883.1.31845 WP_000459883.1.3185 WP_000459883.1.31854 WP_000459883.1.31895 WP_000459883.1.31901 WP_000459883.1.31927 WP_000459883.1.31940 WP_000459883.1.31952 WP_000459883.1.31967 WP_000459883.1.31972 WP_000459883.1.31983 WP_000459883.1.32006 WP_000459883.1.32038 WP_000459883.1.32054 WP_000459883.1.32056 WP_000459883.1.32109 WP_000459883.1.32116 WP_000459883.1.32170 WP_000459883.1.32192 WP_000459883.1.32204 WP_000459883.1.32206 WP_000459883.1.32252 WP_000459883.1.32255 WP_000459883.1.32260 WP_000459883.1.32274 WP_000459883.1.32275 WP_000459883.1.32277 WP_000459883.1.32309 WP_000459883.1.32357 WP_000459883.1.32368 WP_000459883.1.32408 WP_000459883.1.32423 WP_000459883.1.32424 WP_000459883.1.32434 WP_000459883.1.32438 WP_000459883.1.32459 WP_000459883.1.32491 WP_000459883.1.32493 WP_000459883.1.32515 WP_000459883.1.32519 WP_000459883.1.32527 WP_000459883.1.32545 WP_000459883.1.32624 WP_000459883.1.32629 WP_000459883.1.32643 WP_000459883.1.32660 WP_000459883.1.32668 WP_000459883.1.32702 WP_000459883.1.32714 WP_000459883.1.32740 WP_000459883.1.32747 WP_000459883.1.3278 WP_000459883.1.32786 WP_000459883.1.32804 WP_000459883.1.32832 WP_000459883.1.32860 WP_000459883.1.32881 WP_000459883.1.32899 WP_000459883.1.329 WP_000459883.1.32902 WP_000459883.1.32907 WP_000459883.1.32930 WP_000459883.1.32961 WP_000459883.1.32977 WP_000459883.1.33010 WP_000459883.1.33030 WP_000459883.1.3304 WP_000459883.1.33078 WP_000459883.1.3310 WP_000459883.1.33106 WP_000459883.1.33114 WP_000459883.1.33127 WP_000459883.1.33143 WP_000459883.1.33144 WP_000459883.1.33160 WP_000459883.1.33248 WP_000459883.1.33253 WP_000459883.1.33261 WP_000459883.1.33270 WP_000459883.1.333 WP_000459883.1.33409 WP_000459883.1.33420 WP_000459883.1.33486 WP_000459883.1.33492 WP_000459883.1.33499 WP_000459883.1.335 WP_000459883.1.33504 WP_000459883.1.33553 WP_000459883.1.3356 WP_000459883.1.33580 WP_000459883.1.33586 WP_000459883.1.33592 WP_000459883.1.33609 WP_000459883.1.33629 WP_000459883.1.3364 WP_000459883.1.33659 WP_000459883.1.33693 WP_000459883.1.33817 WP_000459883.1.33825 WP_000459883.1.33865 WP_000459883.1.33870 WP_000459883.1.33894 WP_000459883.1.3394 WP_000459883.1.3395 WP_000459883.1.3396 WP_000459883.1.33986 WP_000459883.1.34 WP_000459883.1.34022 WP_000459883.1.34043 WP_000459883.1.34075 WP_000459883.1.34081 WP_000459883.1.34084 WP_000459883.1.34091 WP_000459883.1.34107 WP_000459883.1.34126 WP_000459883.1.34179 WP_000459883.1.34184 WP_000459883.1.34185 WP_000459883.1.34257 WP_000459883.1.34259 WP_000459883.1.34279 WP_000459883.1.34292 WP_000459883.1.34304 WP_000459883.1.34319 WP_000459883.1.34330 WP_000459883.1.3438 WP_000459883.1.34417 WP_000459883.1.34424 WP_000459883.1.34431 WP_000459883.1.3445 WP_000459883.1.34453 WP_000459883.1.34454 WP_000459883.1.34458 WP_000459883.1.34496 WP_000459883.1.34610 WP_000459883.1.34614 WP_000459883.1.34647 WP_000459883.1.34659 WP_000459883.1.34667 WP_000459883.1.34684 WP_000459883.1.34703 WP_000459883.1.34704 WP_000459883.1.34707 WP_000459883.1.34711 WP_000459883.1.34745 WP_000459883.1.3476 WP_000459883.1.34801 WP_000459883.1.34817 WP_000459883.1.34820 WP_000459883.1.34854 WP_000459883.1.34856 WP_000459883.1.34881 WP_000459883.1.3489 WP_000459883.1.34972 WP_000459883.1.34975 WP_000459883.1.34977 WP_000459883.1.35035 WP_000459883.1.35045 WP_000459883.1.35075 WP_000459883.1.35125 WP_000459883.1.35129 WP_000459883.1.35184 WP_000459883.1.35193 WP_000459883.1.35219 WP_000459883.1.35294 WP_000459883.1.35298 WP_000459883.1.35321 WP_000459883.1.35331 WP_000459883.1.35332 WP_000459883.1.35404 WP_000459883.1.35408 WP_000459883.1.3541 WP_000459883.1.35425 WP_000459883.1.35429 WP_000459883.1.35446 WP_000459883.1.35460 WP_000459883.1.35463 WP_000459883.1.35494 WP_000459883.1.35503 WP_000459883.1.35507 WP_000459883.1.35509 WP_000459883.1.3556 WP_000459883.1.35563 WP_000459883.1.35570 WP_000459883.1.35590 WP_000459883.1.35594 WP_000459883.1.35619 WP_000459883.1.35624 WP_000459883.1.35648 WP_000459883.1.3566 WP_000459883.1.3572 WP_000459883.1.35777 WP_000459883.1.35809 WP_000459883.1.35835 WP_000459883.1.35868 WP_000459883.1.35887 WP_000459883.1.35892 WP_000459883.1.35936 WP_000459883.1.35940 WP_000459883.1.35961 WP_000459883.1.35993 WP_000459883.1.36003 WP_000459883.1.3601 WP_000459883.1.36011 WP_000459883.1.36017 WP_000459883.1.36037 WP_000459883.1.36057 WP_000459883.1.36063 WP_000459883.1.3610 WP_000459883.1.36157 WP_000459883.1.36172 WP_000459883.1.36229 WP_000459883.1.36236 WP_000459883.1.36286 WP_000459883.1.36409 WP_000459883.1.36425 WP_000459883.1.36445 WP_000459883.1.36512 WP_000459883.1.36542 WP_000459883.1.36547 WP_000459883.1.36564 WP_000459883.1.36584 WP_000459883.1.36586 WP_000459883.1.36592 WP_000459883.1.36609 WP_000459883.1.36652 WP_000459883.1.36685 WP_000459883.1.36690 WP_000459883.1.3670 WP_000459883.1.36705 WP_000459883.1.36721 WP_000459883.1.36751 WP_000459883.1.36764 WP_000459883.1.36765 WP_000459883.1.36792 WP_000459883.1.36839 WP_000459883.1.36875 WP_000459883.1.3688 WP_000459883.1.36885 WP_000459883.1.36889 WP_000459883.1.36899 WP_000459883.1.36918 WP_000459883.1.36931 WP_000459883.1.36948 WP_000459883.1.36949 WP_000459883.1.36978 WP_000459883.1.37013 WP_000459883.1.37021 WP_000459883.1.37028 WP_000459883.1.37029 WP_000459883.1.37063 WP_000459883.1.37073 WP_000459883.1.37100 WP_000459883.1.37111 WP_000459883.1.37112 WP_000459883.1.37114 WP_000459883.1.37147 WP_000459883.1.37158 WP_000459883.1.37190 WP_000459883.1.37191 WP_000459883.1.37256 WP_000459883.1.3726 WP_000459883.1.37267 WP_000459883.1.3728 WP_000459883.1.37293 WP_000459883.1.37297 WP_000459883.1.37320 WP_000459883.1.3734 WP_000459883.1.37351 WP_000459883.1.37363 WP_000459883.1.37370 WP_000459883.1.37376 WP_000459883.1.37405 WP_000459883.1.3744 WP_000459883.1.37478 WP_000459883.1.3748 WP_000459883.1.37498 WP_000459883.1.37504 WP_000459883.1.3751 WP_000459883.1.37521 WP_000459883.1.37558 WP_000459883.1.3756 WP_000459883.1.37610 WP_000459883.1.37618 WP_000459883.1.37666 WP_000459883.1.37687 WP_000459883.1.3771 WP_000459883.1.37719 WP_000459883.1.3778 WP_000459883.1.37808 WP_000459883.1.37864 WP_000459883.1.3790 WP_000459883.1.37965 WP_000459883.1.37968 WP_000459883.1.37978 WP_000459883.1.38001 WP_000459883.1.38026 WP_000459883.1.38037 WP_000459883.1.38047 WP_000459883.1.38055 WP_000459883.1.38113 WP_000459883.1.38125 WP_000459883.1.38145 WP_000459883.1.38199 WP_000459883.1.38273 WP_000459883.1.3828 WP_000459883.1.383 WP_000459883.1.38322 WP_000459883.1.38344 WP_000459883.1.38349 WP_000459883.1.38393 WP_000459883.1.38408 WP_000459883.1.38452 WP_000459883.1.3848 WP_000459883.1.38512 WP_000459883.1.38569 WP_000459883.1.38609 WP_000459883.1.38613 WP_000459883.1.38620 WP_000459883.1.38622 WP_000459883.1.38673 WP_000459883.1.3869 WP_000459883.1.38693 WP_000459883.1.38740 WP_000459883.1.38773 WP_000459883.1.38781 WP_000459883.1.38797 WP_000459883.1.38830 WP_000459883.1.38857 WP_000459883.1.38881 WP_000459883.1.38882 WP_000459883.1.38895 WP_000459883.1.38898 WP_000459883.1.3891 WP_000459883.1.38913 WP_000459883.1.38942 WP_000459883.1.38995 WP_000459883.1.39003 WP_000459883.1.39038 WP_000459883.1.39048 WP_000459883.1.39055 WP_000459883.1.39059 WP_000459883.1.39065 WP_000459883.1.39075 WP_000459883.1.39082 WP_000459883.1.39112 WP_000459883.1.39113 WP_000459883.1.39128 WP_000459883.1.39136 WP_000459883.1.39140 WP_000459883.1.39146 WP_000459883.1.39183 WP_000459883.1.39197 WP_000459883.1.39229 WP_000459883.1.39265 WP_000459883.1.39275 WP_000459883.1.39311 WP_000459883.1.39312 WP_000459883.1.39385 WP_000459883.1.39395 WP_000459883.1.39405 WP_000459883.1.39414 WP_000459883.1.39420 WP_000459883.1.39449 WP_000459883.1.39471 WP_000459883.1.39497 WP_000459883.1.39503 WP_000459883.1.39512 WP_000459883.1.39553 WP_000459883.1.39556 WP_000459883.1.39576 WP_000459883.1.39584 WP_000459883.1.39609 WP_000459883.1.39614 WP_000459883.1.39629 WP_000459883.1.39632 WP_000459883.1.39723 WP_000459883.1.39724 WP_000459883.1.39763 WP_000459883.1.39808 WP_000459883.1.39862 WP_000459883.1.39921 WP_000459883.1.39923 WP_000459883.1.39953 WP_000459883.1.40008 WP_000459883.1.40017 WP_000459883.1.40025 WP_000459883.1.40031 WP_000459883.1.40072 WP_000459883.1.40073 WP_000459883.1.40081 WP_000459883.1.4011 WP_000459883.1.40111 WP_000459883.1.40158 WP_000459883.1.40170 WP_000459883.1.40205 WP_000459883.1.40208 WP_000459883.1.40224 WP_000459883.1.40229 WP_000459883.1.40240 WP_000459883.1.40254 WP_000459883.1.40257 WP_000459883.1.40258 WP_000459883.1.40259 WP_000459883.1.40284 WP_000459883.1.40292 WP_000459883.1.40305 WP_000459883.1.40307 WP_000459883.1.40311 WP_000459883.1.40341 WP_000459883.1.40374 WP_000459883.1.40380 WP_000459883.1.40395 WP_000459883.1.40465 WP_000459883.1.40492 WP_000459883.1.40493 WP_000459883.1.40508 WP_000459883.1.40528 WP_000459883.1.40533 WP_000459883.1.40577 WP_000459883.1.40583 WP_000459883.1.40605 WP_000459883.1.40622 WP_000459883.1.40648 WP_000459883.1.40688 WP_000459883.1.40693 WP_000459883.1.40695 WP_000459883.1.40710 WP_000459883.1.40722 WP_000459883.1.40745 WP_000459883.1.4075 WP_000459883.1.40771 WP_000459883.1.40788 WP_000459883.1.40849 WP_000459883.1.4087 WP_000459883.1.40877 WP_000459883.1.4088 WP_000459883.1.40910 WP_000459883.1.40930 WP_000459883.1.40973 WP_000459883.1.40979 WP_000459883.1.40996 WP_000459883.1.41017 WP_000459883.1.41018 WP_000459883.1.41048 WP_000459883.1.41050 WP_000459883.1.41086 WP_000459883.1.4109 WP_000459883.1.41091 WP_000459883.1.41116 WP_000459883.1.41128 WP_000459883.1.41192 WP_000459883.1.41226 WP_000459883.1.41265 WP_000459883.1.41277 WP_000459883.1.41279 WP_000459883.1.41299 WP_000459883.1.41308 WP_000459883.1.41310 WP_000459883.1.41345 WP_000459883.1.4141 WP_000459883.1.41427 WP_000459883.1.41434 WP_000459883.1.41438 WP_000459883.1.41440 WP_000459883.1.41468 WP_000459883.1.41516 WP_000459883.1.41528 WP_000459883.1.41554 WP_000459883.1.41572 WP_000459883.1.41591 WP_000459883.1.41593 WP_000459883.1.41610 WP_000459883.1.41628 WP_000459883.1.41662 WP_000459883.1.41688 WP_000459883.1.41690 WP_000459883.1.41708 WP_000459883.1.41724 WP_000459883.1.41735 WP_000459883.1.4178 WP_000459883.1.41789 WP_000459883.1.41799 WP_000459883.1.41802 WP_000459883.1.4184 WP_000459883.1.41859 WP_000459883.1.41862 WP_000459883.1.41877 WP_000459883.1.41882 WP_000459883.1.41897 WP_000459883.1.41904 WP_000459883.1.41911 WP_000459883.1.41931 WP_000459883.1.41938 WP_000459883.1.41949 WP_000459883.1.41978 WP_000459883.1.41979 WP_000459883.1.41985 WP_000459883.1.41994 WP_000459883.1.41998 WP_000459883.1.42009 WP_000459883.1.42098 WP_000459883.1.42104 WP_000459883.1.42109 WP_000459883.1.42136 WP_000459883.1.42156 WP_000459883.1.422 WP_000459883.1.4222 WP_000459883.1.42238 WP_000459883.1.42243 WP_000459883.1.42244 WP_000459883.1.42248 WP_000459883.1.42262 WP_000459883.1.42263 WP_000459883.1.42276 WP_000459883.1.4229 WP_000459883.1.42320 WP_000459883.1.42322 WP_000459883.1.42328 WP_000459883.1.42342 WP_000459883.1.42356 WP_000459883.1.42372 WP_000459883.1.4239 WP_000459883.1.42392 WP_000459883.1.42404 WP_000459883.1.42422 WP_000459883.1.42433 WP_000459883.1.42444 WP_000459883.1.42453 WP_000459883.1.42489 WP_000459883.1.42491 WP_000459883.1.4257 WP_000459883.1.42595 WP_000459883.1.42605 WP_000459883.1.42655 WP_000459883.1.42666 WP_000459883.1.42675 WP_000459883.1.42676 WP_000459883.1.42683 WP_000459883.1.42685 WP_000459883.1.42707 WP_000459883.1.42734 WP_000459883.1.4276 WP_000459883.1.42767 WP_000459883.1.42794 WP_000459883.1.42797 WP_000459883.1.42829 WP_000459883.1.42861 WP_000459883.1.42864 WP_000459883.1.4288 WP_000459883.1.42887 WP_000459883.1.4289 WP_000459883.1.42892 WP_000459883.1.42923 WP_000459883.1.42932 WP_000459883.1.42957 WP_000459883.1.42978 WP_000459883.1.42981 WP_000459883.1.43018 WP_000459883.1.43041 WP_000459883.1.43070 WP_000459883.1.43077 WP_000459883.1.43086 WP_000459883.1.43089 WP_000459883.1.43126 WP_000459883.1.43149 WP_000459883.1.43160 WP_000459883.1.43201 WP_000459883.1.43244 WP_000459883.1.43258 WP_000459883.1.43272 WP_000459883.1.43276 WP_000459883.1.43299 WP_000459883.1.43312 WP_000459883.1.4332 WP_000459883.1.43334 WP_000459883.1.43339 WP_000459883.1.43351 WP_000459883.1.43371 WP_000459883.1.43437 WP_000459883.1.43438 WP_000459883.1.4344 WP_000459883.1.43441 WP_000459883.1.43476 WP_000459883.1.43508 WP_000459883.1.43520 WP_000459883.1.43522 WP_000459883.1.43528 WP_000459883.1.43535 WP_000459883.1.43606 WP_000459883.1.43613 WP_000459883.1.43654 WP_000459883.1.43668 WP_000459883.1.43676 WP_000459883.1.43710 WP_000459883.1.43711 WP_000459883.1.4373 WP_000459883.1.43763 WP_000459883.1.43778 WP_000459883.1.43785 WP_000459883.1.43828 WP_000459883.1.43839 WP_000459883.1.43864 WP_000459883.1.43873 WP_000459883.1.43875 WP_000459883.1.43886 WP_000459883.1.43951 WP_000459883.1.43954 WP_000459883.1.44005 WP_000459883.1.44010 WP_000459883.1.44043 WP_000459883.1.4405 WP_000459883.1.44063 WP_000459883.1.44099 WP_000459883.1.44113 WP_000459883.1.44121 WP_000459883.1.44132 WP_000459883.1.44144 WP_000459883.1.44187 WP_000459883.1.44191 WP_000459883.1.4422 WP_000459883.1.4423 WP_000459883.1.44250 WP_000459883.1.44291 WP_000459883.1.44300 WP_000459883.1.44310 WP_000459883.1.44337 WP_000459883.1.44339 WP_000459883.1.44359 WP_000459883.1.44380 WP_000459883.1.44386 WP_000459883.1.44397 WP_000459883.1.4440 WP_000459883.1.44433 WP_000459883.1.44438 WP_000459883.1.44440 WP_000459883.1.44443 WP_000459883.1.44453 WP_000459883.1.44474 WP_000459883.1.44479 WP_000459883.1.44549 WP_000459883.1.44578 WP_000459883.1.44593 WP_000459883.1.44606 WP_000459883.1.44607 WP_000459883.1.44633 WP_000459883.1.44636 WP_000459883.1.44640 WP_000459883.1.4467 WP_000459883.1.44678 WP_000459883.1.44687 WP_000459883.1.44702 WP_000459883.1.44705 WP_000459883.1.44747 WP_000459883.1.44781 WP_000459883.1.44795 WP_000459883.1.44831 WP_000459883.1.44833 WP_000459883.1.4485 WP_000459883.1.44877 WP_000459883.1.44887 WP_000459883.1.449 WP_000459883.1.44927 WP_000459883.1.44933 WP_000459883.1.44943 WP_000459883.1.44950 WP_000459883.1.44966 WP_000459883.1.44971 WP_000459883.1.44978 WP_000459883.1.44985 WP_000459883.1.44996 WP_000459883.1.44997 WP_000459883.1.44998 WP_000459883.1.4500 WP_000459883.1.45027 WP_000459883.1.45038 WP_000459883.1.45045 WP_000459883.1.4505 WP_000459883.1.45067 WP_000459883.1.45074 WP_000459883.1.45079 WP_000459883.1.45098 WP_000459883.1.45123 WP_000459883.1.45134 WP_000459883.1.45145 WP_000459883.1.45154 WP_000459883.1.45173 WP_000459883.1.45177 WP_000459883.1.45184 WP_000459883.1.45229 WP_000459883.1.45251 WP_000459883.1.45259 WP_000459883.1.45268 WP_000459883.1.45302 WP_000459883.1.4531 WP_000459883.1.45322 WP_000459883.1.45344 WP_000459883.1.45349 WP_000459883.1.45365 WP_000459883.1.4540 WP_000459883.1.45402 WP_000459883.1.45432 WP_000459883.1.45434 WP_000459883.1.45462 WP_000459883.1.45468 WP_000459883.1.45522 WP_000459883.1.45535 WP_000459883.1.45544 WP_000459883.1.45549 WP_000459883.1.45550 WP_000459883.1.45566 WP_000459883.1.45569 WP_000459883.1.45571 WP_000459883.1.45582 WP_000459883.1.45583 WP_000459883.1.45585 WP_000459883.1.45622 WP_000459883.1.45660 WP_000459883.1.45690 WP_000459883.1.45706 WP_000459883.1.45781 WP_000459883.1.45797 WP_000459883.1.458 WP_000459883.1.45844 WP_000459883.1.45848 WP_000459883.1.45906 WP_000459883.1.45918 WP_000459883.1.4592 WP_000459883.1.45984 WP_000459883.1.46011 WP_000459883.1.46028 WP_000459883.1.46069 WP_000459883.1.46091 WP_000459883.1.46112 WP_000459883.1.46173 WP_000459883.1.46174 WP_000459883.1.46187 WP_000459883.1.46203 WP_000459883.1.46205 WP_000459883.1.46215 WP_000459883.1.46232 WP_000459883.1.46243 WP_000459883.1.46250 WP_000459883.1.46278 WP_000459883.1.46286 WP_000459883.1.46299 WP_000459883.1.46303 WP_000459883.1.46322 WP_000459883.1.46323 WP_000459883.1.46345 WP_000459883.1.46358 WP_000459883.1.46406 WP_000459883.1.46434 WP_000459883.1.46444 WP_000459883.1.46499 WP_000459883.1.46572 WP_000459883.1.46574 WP_000459883.1.46578 WP_000459883.1.46595 WP_000459883.1.46620 WP_000459883.1.46637 WP_000459883.1.46666 WP_000459883.1.46675 WP_000459883.1.46689 WP_000459883.1.46693 WP_000459883.1.4671 WP_000459883.1.46726 WP_000459883.1.46730 WP_000459883.1.46732 WP_000459883.1.4674 WP_000459883.1.46749 WP_000459883.1.46803 WP_000459883.1.46804 WP_000459883.1.4686 WP_000459883.1.46930 WP_000459883.1.46961 WP_000459883.1.46967 WP_000459883.1.46976 WP_000459883.1.47005 WP_000459883.1.47008 WP_000459883.1.47014 WP_000459883.1.47023 WP_000459883.1.47057 WP_000459883.1.47058 WP_000459883.1.47061 WP_000459883.1.47067 WP_000459883.1.47110 WP_000459883.1.47243 WP_000459883.1.47257 WP_000459883.1.47389 WP_000459883.1.47429 WP_000459883.1.47442 WP_000459883.1.47448 WP_000459883.1.47460 WP_000459883.1.4747 WP_000459883.1.47472 WP_000459883.1.47478 WP_000459883.1.47492 WP_000459883.1.47506 WP_000459883.1.47507 WP_000459883.1.47542 WP_000459883.1.47567 WP_000459883.1.47576 WP_000459883.1.47579 WP_000459883.1.4758 WP_000459883.1.47587 WP_000459883.1.47614 WP_000459883.1.47621 WP_000459883.1.47649 WP_000459883.1.47660 WP_000459883.1.4770 WP_000459883.1.47714 WP_000459883.1.4775 WP_000459883.1.47767 WP_000459883.1.47799 WP_000459883.1.47814 WP_000459883.1.47817 WP_000459883.1.47829 WP_000459883.1.47849 WP_000459883.1.47850 WP_000459883.1.47875 WP_000459883.1.47902 WP_000459883.1.47911 WP_000459883.1.47928 WP_000459883.1.4795 WP_000459883.1.47988 WP_000459883.1.47992 WP_000459883.1.48124 WP_000459883.1.48132 WP_000459883.1.48134 WP_000459883.1.48209 WP_000459883.1.48215 WP_000459883.1.48218 WP_000459883.1.48242 WP_000459883.1.48247 WP_000459883.1.48253 WP_000459883.1.48262 WP_000459883.1.48268 WP_000459883.1.483 WP_000459883.1.48367 WP_000459883.1.48377 WP_000459883.1.4839 WP_000459883.1.48455 WP_000459883.1.48493 WP_000459883.1.48510 WP_000459883.1.48524 WP_000459883.1.4853 WP_000459883.1.48570 WP_000459883.1.48647 WP_000459883.1.48651 WP_000459883.1.48751 WP_000459883.1.48755 WP_000459883.1.48768 WP_000459883.1.48774 WP_000459883.1.48788 WP_000459883.1.48797 WP_000459883.1.48841 WP_000459883.1.4885 WP_000459883.1.48855 WP_000459883.1.48876 WP_000459883.1.48886 WP_000459883.1.48894 WP_000459883.1.48908 WP_000459883.1.48918 WP_000459883.1.48919 WP_000459883.1.48931 WP_000459883.1.48985 WP_000459883.1.49005 WP_000459883.1.49012 WP_000459883.1.49084 WP_000459883.1.49090 WP_000459883.1.49102 WP_000459883.1.49113 WP_000459883.1.49155 WP_000459883.1.49162 WP_000459883.1.49175 WP_000459883.1.49204 WP_000459883.1.49214 WP_000459883.1.49226 WP_000459883.1.49233 WP_000459883.1.49239 WP_000459883.1.49256 WP_000459883.1.49262 WP_000459883.1.49276 WP_000459883.1.49290 WP_000459883.1.49304 WP_000459883.1.49309 WP_000459883.1.49311 WP_000459883.1.49334 WP_000459883.1.49340 WP_000459883.1.49358 WP_000459883.1.49366 WP_000459883.1.49375 WP_000459883.1.49430 WP_000459883.1.49443 WP_000459883.1.49472 WP_000459883.1.49490 WP_000459883.1.49494 WP_000459883.1.49515 WP_000459883.1.49550 WP_000459883.1.49572 WP_000459883.1.49574 WP_000459883.1.49590 WP_000459883.1.49602 WP_000459883.1.49626 WP_000459883.1.49647 WP_000459883.1.49650 WP_000459883.1.49686 WP_000459883.1.49770 WP_000459883.1.49778 WP_000459883.1.49780 WP_000459883.1.4979 WP_000459883.1.49790 WP_000459883.1.49805 WP_000459883.1.49827 WP_000459883.1.49848 WP_000459883.1.49929 WP_000459883.1.49931 WP_000459883.1.50 WP_000459883.1.50003 WP_000459883.1.50007 WP_000459883.1.50080 WP_000459883.1.5009 WP_000459883.1.50128 WP_000459883.1.50153 WP_000459883.1.50161 WP_000459883.1.50198 WP_000459883.1.50211 WP_000459883.1.50238 WP_000459883.1.50239 WP_000459883.1.50251 WP_000459883.1.50285 WP_000459883.1.50332 WP_000459883.1.50349 WP_000459883.1.50374 WP_000459883.1.50376 WP_000459883.1.50386 WP_000459883.1.50389 WP_000459883.1.50404 WP_000459883.1.50413 WP_000459883.1.50449 WP_000459883.1.50469 WP_000459883.1.50478 WP_000459883.1.50480 WP_000459883.1.50497 WP_000459883.1.50517 WP_000459883.1.50529 WP_000459883.1.50563 WP_000459883.1.50565 WP_000459883.1.50576 WP_000459883.1.5058 WP_000459883.1.50593 WP_000459883.1.50652 WP_000459883.1.50676 WP_000459883.1.50684 WP_000459883.1.50750 WP_000459883.1.50769 WP_000459883.1.50774 WP_000459883.1.50777 WP_000459883.1.50782 WP_000459883.1.50800 WP_000459883.1.50804 WP_000459883.1.50808 WP_000459883.1.50811 WP_000459883.1.5088 WP_000459883.1.50882 WP_000459883.1.50893 WP_000459883.1.50905 WP_000459883.1.50908 WP_000459883.1.50918 WP_000459883.1.50941 WP_000459883.1.50954 WP_000459883.1.50960 WP_000459883.1.50999 WP_000459883.1.51014 WP_000459883.1.51022 WP_000459883.1.51025 WP_000459883.1.51036 WP_000459883.1.51066 WP_000459883.1.51117 WP_000459883.1.51131 WP_000459883.1.51139 WP_000459883.1.5114 WP_000459883.1.51162 WP_000459883.1.51178 WP_000459883.1.51179 WP_000459883.1.51182 WP_000459883.1.51186 WP_000459883.1.51224 WP_000459883.1.5125 WP_000459883.1.51285 WP_000459883.1.51308 WP_000459883.1.51331 WP_000459883.1.51338 WP_000459883.1.51356 WP_000459883.1.51394 WP_000459883.1.51412 WP_000459883.1.51414 WP_000459883.1.51419 WP_000459883.1.51451 WP_000459883.1.51464 WP_000459883.1.51487 WP_000459883.1.51488 WP_000459883.1.51502 WP_000459883.1.51506 WP_000459883.1.51514 WP_000459883.1.51518 WP_000459883.1.51555 WP_000459883.1.51594 WP_000459883.1.51611 WP_000459883.1.51613 WP_000459883.1.51615 WP_000459883.1.51634 WP_000459883.1.51642 WP_000459883.1.51649 WP_000459883.1.51686 WP_000459883.1.51700 WP_000459883.1.51704 WP_000459883.1.51756 WP_000459883.1.51764 WP_000459883.1.51810 WP_000459883.1.51841 WP_000459883.1.5185 WP_000459883.1.51868 WP_000459883.1.51888 WP_000459883.1.51900 WP_000459883.1.51910 WP_000459883.1.51911 WP_000459883.1.51914 WP_000459883.1.51930 WP_000459883.1.51932 WP_000459883.1.51989 WP_000459883.1.51994 WP_000459883.1.520 WP_000459883.1.52047 WP_000459883.1.52101 WP_000459883.1.5211 WP_000459883.1.52121 WP_000459883.1.52123 WP_000459883.1.52148 WP_000459883.1.52156 WP_000459883.1.5216 WP_000459883.1.52170 WP_000459883.1.52255 WP_000459883.1.52301 WP_000459883.1.52321 WP_000459883.1.52336 WP_000459883.1.52346 WP_000459883.1.52353 WP_000459883.1.52356 WP_000459883.1.52361 WP_000459883.1.52438 WP_000459883.1.52456 WP_000459883.1.52527 WP_000459883.1.52528 WP_000459883.1.52582 WP_000459883.1.52586 WP_000459883.1.52608 WP_000459883.1.52653 WP_000459883.1.52656 WP_000459883.1.52675 WP_000459883.1.52692 WP_000459883.1.5273 WP_000459883.1.52743 WP_000459883.1.52744 WP_000459883.1.52748 WP_000459883.1.52824 WP_000459883.1.52833 WP_000459883.1.52851 WP_000459883.1.52857 WP_000459883.1.52858 WP_000459883.1.52866 WP_000459883.1.52898 WP_000459883.1.52915 WP_000459883.1.52924 WP_000459883.1.52949 WP_000459883.1.52985 WP_000459883.1.5301 WP_000459883.1.53016 WP_000459883.1.53100 WP_000459883.1.53107 WP_000459883.1.53119 WP_000459883.1.5313 WP_000459883.1.53158 WP_000459883.1.5316 WP_000459883.1.53179 WP_000459883.1.53190 WP_000459883.1.53198 WP_000459883.1.53203 WP_000459883.1.53206 WP_000459883.1.53234 WP_000459883.1.53272 WP_000459883.1.53274 WP_000459883.1.53286 WP_000459883.1.53315 WP_000459883.1.53316 WP_000459883.1.53328 WP_000459883.1.5333 WP_000459883.1.53362 WP_000459883.1.53385 WP_000459883.1.53406 WP_000459883.1.53436 WP_000459883.1.53454 WP_000459883.1.53466 WP_000459883.1.53529 WP_000459883.1.53534 WP_000459883.1.53543 WP_000459883.1.53567 WP_000459883.1.53664 WP_000459883.1.53675 WP_000459883.1.53688 WP_000459883.1.53694 WP_000459883.1.53696 WP_000459883.1.53772 WP_000459883.1.53778 WP_000459883.1.53781 WP_000459883.1.53812 WP_000459883.1.53814 WP_000459883.1.53896 WP_000459883.1.53905 WP_000459883.1.5392 WP_000459883.1.53935 WP_000459883.1.53961 WP_000459883.1.54033 WP_000459883.1.54061 WP_000459883.1.54068 WP_000459883.1.54075 WP_000459883.1.54082 WP_000459883.1.54136 WP_000459883.1.5415 WP_000459883.1.54159 WP_000459883.1.54196 WP_000459883.1.542 WP_000459883.1.54209 WP_000459883.1.54271 WP_000459883.1.54273 WP_000459883.1.54274 WP_000459883.1.54283 WP_000459883.1.54319 WP_000459883.1.54333 WP_000459883.1.54340 WP_000459883.1.54364 WP_000459883.1.54366 WP_000459883.1.54400 WP_000459883.1.54469 WP_000459883.1.54500 WP_000459883.1.54522 WP_000459883.1.54526 WP_000459883.1.54558 WP_000459883.1.5456 WP_000459883.1.54569 WP_000459883.1.5459 WP_000459883.1.54607 WP_000459883.1.54615 WP_000459883.1.5462 WP_000459883.1.54644 WP_000459883.1.54662 WP_000459883.1.54694 WP_000459883.1.54722 WP_000459883.1.54749 WP_000459883.1.54764 WP_000459883.1.54774 WP_000459883.1.54814 WP_000459883.1.54822 WP_000459883.1.54827 WP_000459883.1.54833 WP_000459883.1.54845 WP_000459883.1.5485 WP_000459883.1.54877 WP_000459883.1.5493 WP_000459883.1.54936 WP_000459883.1.54984 WP_000459883.1.54992 WP_000459883.1.55008 WP_000459883.1.55073 WP_000459883.1.55152 WP_000459883.1.55156 WP_000459883.1.55166 WP_000459883.1.5517 WP_000459883.1.55178 WP_000459883.1.55200 WP_000459883.1.55223 WP_000459883.1.55224 WP_000459883.1.5523 WP_000459883.1.5525 WP_000459883.1.5527 WP_000459883.1.55285 WP_000459883.1.55294 WP_000459883.1.55325 WP_000459883.1.55361 WP_000459883.1.55418 WP_000459883.1.55430 WP_000459883.1.55461 WP_000459883.1.55475 WP_000459883.1.55477 WP_000459883.1.55496 WP_000459883.1.55545 WP_000459883.1.5555 WP_000459883.1.55554 WP_000459883.1.55557 WP_000459883.1.55559 WP_000459883.1.5560 WP_000459883.1.55614 WP_000459883.1.55623 WP_000459883.1.55640 WP_000459883.1.55647 WP_000459883.1.55672 WP_000459883.1.55680 WP_000459883.1.55706 WP_000459883.1.55718 WP_000459883.1.5572 WP_000459883.1.55743 WP_000459883.1.55768 WP_000459883.1.5577 WP_000459883.1.55782 WP_000459883.1.55796 WP_000459883.1.55803 WP_000459883.1.55853 WP_000459883.1.55923 WP_000459883.1.55948 WP_000459883.1.55973 WP_000459883.1.55993 WP_000459883.1.56002 WP_000459883.1.56004 WP_000459883.1.56012 WP_000459883.1.56026 WP_000459883.1.56059 WP_000459883.1.56069 WP_000459883.1.56070 WP_000459883.1.56082 WP_000459883.1.56097 WP_000459883.1.56100 WP_000459883.1.56105 WP_000459883.1.56130 WP_000459883.1.56152 WP_000459883.1.56222 WP_000459883.1.56235 WP_000459883.1.56238 WP_000459883.1.56244 WP_000459883.1.56247 WP_000459883.1.56261 WP_000459883.1.56263 WP_000459883.1.56286 WP_000459883.1.56303 WP_000459883.1.56304 WP_000459883.1.56305 WP_000459883.1.56354 WP_000459883.1.56368 WP_000459883.1.56370 WP_000459883.1.56374 WP_000459883.1.56385 WP_000459883.1.56389 WP_000459883.1.56393 WP_000459883.1.56413 WP_000459883.1.56414 WP_000459883.1.56420 WP_000459883.1.56438 WP_000459883.1.56468 WP_000459883.1.56512 WP_000459883.1.56559 WP_000459883.1.56560 WP_000459883.1.56597 WP_000459883.1.56601 WP_000459883.1.56614 WP_000459883.1.56615 WP_000459883.1.56642 WP_000459883.1.56647 WP_000459883.1.56651 WP_000459883.1.56660 WP_000459883.1.56671 WP_000459883.1.5668 WP_000459883.1.56682 WP_000459883.1.56791 WP_000459883.1.56851 WP_000459883.1.56853 WP_000459883.1.56861 WP_000459883.1.56875 WP_000459883.1.56877 WP_000459883.1.56893 WP_000459883.1.56898 WP_000459883.1.56905 WP_000459883.1.56942 WP_000459883.1.56950 WP_000459883.1.57000 WP_000459883.1.57026 WP_000459883.1.57039 WP_000459883.1.57056 WP_000459883.1.57076 WP_000459883.1.57084 WP_000459883.1.5711 WP_000459883.1.57125 WP_000459883.1.57143 WP_000459883.1.57149 WP_000459883.1.57168 WP_000459883.1.57187 WP_000459883.1.57232 WP_000459883.1.57233 WP_000459883.1.57244 WP_000459883.1.57246 WP_000459883.1.57296 WP_000459883.1.57307 WP_000459883.1.57344 WP_000459883.1.57356 WP_000459883.1.57357 WP_000459883.1.57362 WP_000459883.1.57377 WP_000459883.1.57399 WP_000459883.1.57418 WP_000459883.1.57433 WP_000459883.1.57494 WP_000459883.1.57495 WP_000459883.1.57510 WP_000459883.1.57515 WP_000459883.1.57521 WP_000459883.1.57529 WP_000459883.1.5753 WP_000459883.1.57534 WP_000459883.1.57555 WP_000459883.1.57559 WP_000459883.1.57576 WP_000459883.1.57601 WP_000459883.1.57607 WP_000459883.1.5761 WP_000459883.1.57631 WP_000459883.1.57641 WP_000459883.1.57709 WP_000459883.1.57710 WP_000459883.1.57735 WP_000459883.1.5774 WP_000459883.1.57763 WP_000459883.1.57778 WP_000459883.1.57781 WP_000459883.1.57797 WP_000459883.1.5781 WP_000459883.1.57835 WP_000459883.1.57857 WP_000459883.1.57862 WP_000459883.1.57890 WP_000459883.1.57891 WP_000459883.1.57893 WP_000459883.1.57902 WP_000459883.1.57978 WP_000459883.1.5801 WP_000459883.1.58040 WP_000459883.1.58041 WP_000459883.1.58090 WP_000459883.1.58131 WP_000459883.1.58144 WP_000459883.1.58153 WP_000459883.1.58157 WP_000459883.1.58239 WP_000459883.1.58249 WP_000459883.1.58251 WP_000459883.1.5828 WP_000459883.1.58290 WP_000459883.1.58301 WP_000459883.1.58334 WP_000459883.1.58357 WP_000459883.1.58358 WP_000459883.1.58372 WP_000459883.1.58407 WP_000459883.1.58416 WP_000459883.1.58418 WP_000459883.1.58442 WP_000459883.1.58443 WP_000459883.1.58451 WP_000459883.1.5846 WP_000459883.1.58467 WP_000459883.1.58486 WP_000459883.1.58489 WP_000459883.1.5854 WP_000459883.1.58548 WP_000459883.1.58564 WP_000459883.1.5858 WP_000459883.1.58604 WP_000459883.1.58633 WP_000459883.1.58662 WP_000459883.1.58669 WP_000459883.1.58675 WP_000459883.1.58698 WP_000459883.1.587 WP_000459883.1.58729 WP_000459883.1.58745 WP_000459883.1.58749 WP_000459883.1.5878 WP_000459883.1.58803 WP_000459883.1.58831 WP_000459883.1.58834 WP_000459883.1.58836 WP_000459883.1.5886 WP_000459883.1.58861 WP_000459883.1.58884 WP_000459883.1.58926 WP_000459883.1.58932 WP_000459883.1.59006 WP_000459883.1.59012 WP_000459883.1.59068 WP_000459883.1.59084 WP_000459883.1.59094 WP_000459883.1.59097 WP_000459883.1.59125 WP_000459883.1.59136 WP_000459883.1.59142 WP_000459883.1.59148 WP_000459883.1.59163 WP_000459883.1.59224 WP_000459883.1.59236 WP_000459883.1.59276 WP_000459883.1.5929 WP_000459883.1.59294 WP_000459883.1.59295 WP_000459883.1.59321 WP_000459883.1.59335 WP_000459883.1.59336 WP_000459883.1.59375 WP_000459883.1.59381 WP_000459883.1.59412 WP_000459883.1.59420 WP_000459883.1.59427 WP_000459883.1.59439 WP_000459883.1.59458 WP_000459883.1.59486 WP_000459883.1.59490 WP_000459883.1.59508 WP_000459883.1.59512 WP_000459883.1.59521 WP_000459883.1.5953 WP_000459883.1.59538 WP_000459883.1.59548 WP_000459883.1.59562 WP_000459883.1.59587 WP_000459883.1.59604 WP_000459883.1.59636 WP_000459883.1.59641 WP_000459883.1.59646 WP_000459883.1.59648 WP_000459883.1.59684 WP_000459883.1.59694 WP_000459883.1.59709 WP_000459883.1.59710 WP_000459883.1.59755 WP_000459883.1.59771 WP_000459883.1.5979 WP_000459883.1.59830 WP_000459883.1.59848 WP_000459883.1.59928 WP_000459883.1.5993 WP_000459883.1.59933 WP_000459883.1.59953 WP_000459883.1.59979 WP_000459883.1.60004 WP_000459883.1.60008 WP_000459883.1.60015 WP_000459883.1.60021 WP_000459883.1.60052 WP_000459883.1.60069 WP_000459883.1.60106 WP_000459883.1.60126 WP_000459883.1.60137 WP_000459883.1.60140 WP_000459883.1.60155 WP_000459883.1.60209 WP_000459883.1.60213 WP_000459883.1.60226 WP_000459883.1.60231 WP_000459883.1.60285 WP_000459883.1.60320 WP_000459883.1.6033 WP_000459883.1.60330 WP_000459883.1.60370 WP_000459883.1.60379 WP_000459883.1.60425 WP_000459883.1.60464 WP_000459883.1.60486 WP_000459883.1.60503 WP_000459883.1.6052 WP_000459883.1.60545 WP_000459883.1.60560 WP_000459883.1.60561 WP_000459883.1.60597 WP_000459883.1.60608 WP_000459883.1.60622 WP_000459883.1.60643 WP_000459883.1.60661 WP_000459883.1.60713 WP_000459883.1.60746 WP_000459883.1.60760 WP_000459883.1.60772 WP_000459883.1.60794 WP_000459883.1.608 WP_000459883.1.60809 WP_000459883.1.60838 WP_000459883.1.60851 WP_000459883.1.60855 WP_000459883.1.60857 WP_000459883.1.6086 WP_000459883.1.60863 WP_000459883.1.60866 WP_000459883.1.60874 WP_000459883.1.60897 WP_000459883.1.6090 WP_000459883.1.60919 WP_000459883.1.60926 WP_000459883.1.60941 WP_000459883.1.60976 WP_000459883.1.60988 WP_000459883.1.60990 WP_000459883.1.61045 WP_000459883.1.61078 WP_000459883.1.6108 WP_000459883.1.61087 WP_000459883.1.61114 WP_000459883.1.6114 WP_000459883.1.61146 WP_000459883.1.61184 WP_000459883.1.61200 WP_000459883.1.61201 WP_000459883.1.61218 WP_000459883.1.61232 WP_000459883.1.61233 WP_000459883.1.6129 WP_000459883.1.61296 WP_000459883.1.61309 WP_000459883.1.61345 WP_000459883.1.61356 WP_000459883.1.61381 WP_000459883.1.61417 WP_000459883.1.6143 WP_000459883.1.61434 WP_000459883.1.61497 WP_000459883.1.61501 WP_000459883.1.61509 WP_000459883.1.61574 WP_000459883.1.61582 WP_000459883.1.61594 WP_000459883.1.61595 WP_000459883.1.61609 WP_000459883.1.6164 WP_000459883.1.61662 WP_000459883.1.61667 WP_000459883.1.61671 WP_000459883.1.61694 WP_000459883.1.61712 WP_000459883.1.61714 WP_000459883.1.61730 WP_000459883.1.61732 WP_000459883.1.61737 WP_000459883.1.61743 WP_000459883.1.61783 WP_000459883.1.61857 WP_000459883.1.6190 WP_000459883.1.61908 WP_000459883.1.61918 WP_000459883.1.61922 WP_000459883.1.61924 WP_000459883.1.61952 WP_000459883.1.61968 WP_000459883.1.62007 WP_000459883.1.62020 WP_000459883.1.62025 WP_000459883.1.62063 WP_000459883.1.62076 WP_000459883.1.6209 WP_000459883.1.6210 WP_000459883.1.62108 WP_000459883.1.62120 WP_000459883.1.62122 WP_000459883.1.62142 WP_000459883.1.62144 WP_000459883.1.62158 WP_000459883.1.62184 WP_000459883.1.62195 WP_000459883.1.62201 WP_000459883.1.62204 WP_000459883.1.62210 WP_000459883.1.62219 WP_000459883.1.62222 WP_000459883.1.62241 WP_000459883.1.62245 WP_000459883.1.62257 WP_000459883.1.62271 WP_000459883.1.62304 WP_000459883.1.62310 WP_000459883.1.62339 WP_000459883.1.62344 WP_000459883.1.62361 WP_000459883.1.62364 WP_000459883.1.62374 WP_000459883.1.62403 WP_000459883.1.62404 WP_000459883.1.62412 WP_000459883.1.62486 WP_000459883.1.62488 WP_000459883.1.62504 WP_000459883.1.62522 WP_000459883.1.6253 WP_000459883.1.62564 WP_000459883.1.62570 WP_000459883.1.62619 WP_000459883.1.62648 WP_000459883.1.62677 WP_000459883.1.62693 WP_000459883.1.627 WP_000459883.1.62725 WP_000459883.1.62745 WP_000459883.1.62757 WP_000459883.1.62798 WP_000459883.1.62828 WP_000459883.1.62853 WP_000459883.1.62903 WP_000459883.1.62910 WP_000459883.1.6292 WP_000459883.1.62955 WP_000459883.1.62976 WP_000459883.1.62983 WP_000459883.1.62988 WP_000459883.1.63043 WP_000459883.1.63045 WP_000459883.1.63063 WP_000459883.1.63102 WP_000459883.1.63118 WP_000459883.1.63129 WP_000459883.1.63135 WP_000459883.1.63155 WP_000459883.1.63181 WP_000459883.1.63186 WP_000459883.1.63203 WP_000459883.1.63229 WP_000459883.1.63234 WP_000459883.1.63243 WP_000459883.1.63250 WP_000459883.1.63256 WP_000459883.1.63290 WP_000459883.1.63358 WP_000459883.1.63382 WP_000459883.1.63422 WP_000459883.1.63432 WP_000459883.1.63455 WP_000459883.1.63461 WP_000459883.1.63479 WP_000459883.1.63497 WP_000459883.1.63499 WP_000459883.1.63509 WP_000459883.1.63513 WP_000459883.1.63525 WP_000459883.1.63529 WP_000459883.1.63532 WP_000459883.1.63568 WP_000459883.1.6357 WP_000459883.1.63577 WP_000459883.1.63585 WP_000459883.1.63603 WP_000459883.1.63633 WP_000459883.1.63664 WP_000459883.1.6367 WP_000459883.1.63677 WP_000459883.1.63690 WP_000459883.1.6370 WP_000459883.1.63718 WP_000459883.1.63748 WP_000459883.1.6375 WP_000459883.1.63757 WP_000459883.1.63766 WP_000459883.1.63781 WP_000459883.1.63782 WP_000459883.1.63797 WP_000459883.1.63824 WP_000459883.1.63831 WP_000459883.1.63834 WP_000459883.1.63851 WP_000459883.1.63860 WP_000459883.1.63863 WP_000459883.1.63864 WP_000459883.1.63866 WP_000459883.1.63903 WP_000459883.1.63912 WP_000459883.1.63934 WP_000459883.1.63958 WP_000459883.1.63977 WP_000459883.1.6399 WP_000459883.1.63992 WP_000459883.1.64007 WP_000459883.1.64010 WP_000459883.1.64018 WP_000459883.1.64034 WP_000459883.1.64046 WP_000459883.1.64085 WP_000459883.1.64109 WP_000459883.1.64121 WP_000459883.1.64157 WP_000459883.1.64208 WP_000459883.1.64217 WP_000459883.1.64229 WP_000459883.1.6423 WP_000459883.1.64242 WP_000459883.1.64244 WP_000459883.1.64266 WP_000459883.1.64294 WP_000459883.1.64350 WP_000459883.1.6437 WP_000459883.1.64374 WP_000459883.1.64385 WP_000459883.1.64387 WP_000459883.1.64389 WP_000459883.1.64403 WP_000459883.1.64412 WP_000459883.1.64462 WP_000459883.1.64500 WP_000459883.1.6451 WP_000459883.1.64569 WP_000459883.1.64597 WP_000459883.1.64645 WP_000459883.1.64649 WP_000459883.1.64667 WP_000459883.1.64674 WP_000459883.1.64690 WP_000459883.1.64702 WP_000459883.1.64711 WP_000459883.1.64757 WP_000459883.1.64758 WP_000459883.1.64771 WP_000459883.1.64781 WP_000459883.1.64798 WP_000459883.1.64831 WP_000459883.1.6489 WP_000459883.1.64894 WP_000459883.1.64919 WP_000459883.1.64920 WP_000459883.1.64944 WP_000459883.1.64972 WP_000459883.1.64977 WP_000459883.1.65011 WP_000459883.1.65016 WP_000459883.1.65018 WP_000459883.1.65022 WP_000459883.1.65027 WP_000459883.1.65028 WP_000459883.1.65052 WP_000459883.1.65163 WP_000459883.1.65168 WP_000459883.1.65171 WP_000459883.1.65185 WP_000459883.1.65238 WP_000459883.1.65248 WP_000459883.1.6525 WP_000459883.1.65269 WP_000459883.1.65295 WP_000459883.1.65348 WP_000459883.1.6535 WP_000459883.1.65357 WP_000459883.1.65363 WP_000459883.1.65394 WP_000459883.1.65437 WP_000459883.1.65474 WP_000459883.1.65475 WP_000459883.1.6550 WP_000459883.1.65538 WP_000459883.1.65558 WP_000459883.1.65572 WP_000459883.1.6560 WP_000459883.1.65601 WP_000459883.1.6561 WP_000459883.1.65633 WP_000459883.1.6565 WP_000459883.1.65687 WP_000459883.1.65696 WP_000459883.1.65698 WP_000459883.1.6572 WP_000459883.1.6575 WP_000459883.1.65771 WP_000459883.1.65782 WP_000459883.1.65790 WP_000459883.1.65795 WP_000459883.1.65818 WP_000459883.1.65838 WP_000459883.1.65849 WP_000459883.1.65876 WP_000459883.1.65881 WP_000459883.1.65883 WP_000459883.1.65901 WP_000459883.1.65940 WP_000459883.1.65945 WP_000459883.1.6595 WP_000459883.1.65956 WP_000459883.1.65968 WP_000459883.1.66049 WP_000459883.1.66074 WP_000459883.1.66082 WP_000459883.1.66085 WP_000459883.1.66122 WP_000459883.1.66129 WP_000459883.1.66167 WP_000459883.1.66171 WP_000459883.1.66235 WP_000459883.1.66250 WP_000459883.1.66270 WP_000459883.1.66272 WP_000459883.1.66289 WP_000459883.1.6630 WP_000459883.1.66314 WP_000459883.1.66315 WP_000459883.1.66330 WP_000459883.1.66358 WP_000459883.1.66362 WP_000459883.1.66365 WP_000459883.1.66368 WP_000459883.1.6638 WP_000459883.1.66385 WP_000459883.1.6640 WP_000459883.1.66400 WP_000459883.1.66428 WP_000459883.1.66446 WP_000459883.1.66462 WP_000459883.1.6647 WP_000459883.1.66492 WP_000459883.1.66534 WP_000459883.1.66539 WP_000459883.1.66600 WP_000459883.1.66630 WP_000459883.1.66678 WP_000459883.1.66698 WP_000459883.1.66702 WP_000459883.1.66733 WP_000459883.1.66779 WP_000459883.1.6680 WP_000459883.1.66800 WP_000459883.1.66807 WP_000459883.1.66820 WP_000459883.1.66824 WP_000459883.1.66825 WP_000459883.1.66834 WP_000459883.1.66876 WP_000459883.1.66901 WP_000459883.1.6692 WP_000459883.1.66937 WP_000459883.1.66959 WP_000459883.1.66962 WP_000459883.1.67 WP_000459883.1.67037 WP_000459883.1.67045 WP_000459883.1.67075 WP_000459883.1.6710 WP_000459883.1.67100 WP_000459883.1.67173 WP_000459883.1.67175 WP_000459883.1.67181 WP_000459883.1.67184 WP_000459883.1.67228 WP_000459883.1.67235 WP_000459883.1.67268 WP_000459883.1.67279 WP_000459883.1.67288 WP_000459883.1.67347 WP_000459883.1.67374 WP_000459883.1.6739 WP_000459883.1.67405 WP_000459883.1.67424 WP_000459883.1.67465 WP_000459883.1.67552 WP_000459883.1.6760 WP_000459883.1.67603 WP_000459883.1.67617 WP_000459883.1.67633 WP_000459883.1.67637 WP_000459883.1.67682 WP_000459883.1.67707 WP_000459883.1.67731 WP_000459883.1.67772 WP_000459883.1.67776 WP_000459883.1.67803 WP_000459883.1.67814 WP_000459883.1.6782 WP_000459883.1.67825 WP_000459883.1.67827 WP_000459883.1.67829 WP_000459883.1.6785 WP_000459883.1.67887 WP_000459883.1.67905 WP_000459883.1.67924 WP_000459883.1.67932 WP_000459883.1.67942 WP_000459883.1.67969 WP_000459883.1.67970 WP_000459883.1.67977 WP_000459883.1.67988 WP_000459883.1.68036 WP_000459883.1.68073 WP_000459883.1.68075 WP_000459883.1.6809 WP_000459883.1.68115 WP_000459883.1.68140 WP_000459883.1.68147 WP_000459883.1.68159 WP_000459883.1.68167 WP_000459883.1.68201 WP_000459883.1.68206 WP_000459883.1.68210 WP_000459883.1.6827 WP_000459883.1.68275 WP_000459883.1.6833 WP_000459883.1.68401 WP_000459883.1.68477 WP_000459883.1.68478 WP_000459883.1.6849 WP_000459883.1.685 WP_000459883.1.68532 WP_000459883.1.68547 WP_000459883.1.6858 WP_000459883.1.68589 WP_000459883.1.68591 WP_000459883.1.68629 WP_000459883.1.68652 WP_000459883.1.68655 WP_000459883.1.68656 WP_000459883.1.68677 WP_000459883.1.6869 WP_000459883.1.68690 WP_000459883.1.6875 WP_000459883.1.68778 WP_000459883.1.68787 WP_000459883.1.6879 WP_000459883.1.68816 WP_000459883.1.68818 WP_000459883.1.6882 WP_000459883.1.6883 WP_000459883.1.68893 WP_000459883.1.68894 WP_000459883.1.68895 WP_000459883.1.68928 WP_000459883.1.68958 WP_000459883.1.68975 WP_000459883.1.69001 WP_000459883.1.69006 WP_000459883.1.69011 WP_000459883.1.6904 WP_000459883.1.6905 WP_000459883.1.69058 WP_000459883.1.6907 WP_000459883.1.69080 WP_000459883.1.69086 WP_000459883.1.6913 WP_000459883.1.69131 WP_000459883.1.69139 WP_000459883.1.69146 WP_000459883.1.69151 WP_000459883.1.69236 WP_000459883.1.69255 WP_000459883.1.69273 WP_000459883.1.69288 WP_000459883.1.69296 WP_000459883.1.69320 WP_000459883.1.69346 WP_000459883.1.69357 WP_000459883.1.69359 WP_000459883.1.69371 WP_000459883.1.69385 WP_000459883.1.69397 WP_000459883.1.69433 WP_000459883.1.69465 WP_000459883.1.69485 WP_000459883.1.69515 WP_000459883.1.6954 WP_000459883.1.69554 WP_000459883.1.69564 WP_000459883.1.69575 WP_000459883.1.69588 WP_000459883.1.69592 WP_000459883.1.69597 WP_000459883.1.69616 WP_000459883.1.69636 WP_000459883.1.69644 WP_000459883.1.69696 WP_000459883.1.69704 WP_000459883.1.69710 WP_000459883.1.69754 WP_000459883.1.69758 WP_000459883.1.69760 WP_000459883.1.69767 WP_000459883.1.69785 WP_000459883.1.69790 WP_000459883.1.69807 WP_000459883.1.69808 WP_000459883.1.69817 WP_000459883.1.69839 WP_000459883.1.69848 WP_000459883.1.69890 WP_000459883.1.69965 WP_000459883.1.69975 WP_000459883.1.69982 WP_000459883.1.70003 WP_000459883.1.70047 WP_000459883.1.70087 WP_000459883.1.70088 WP_000459883.1.7010 WP_000459883.1.7014 WP_000459883.1.7016 WP_000459883.1.70169 WP_000459883.1.70183 WP_000459883.1.7021 WP_000459883.1.70241 WP_000459883.1.70248 WP_000459883.1.70269 WP_000459883.1.70272 WP_000459883.1.70281 WP_000459883.1.70289 WP_000459883.1.70290 WP_000459883.1.70303 WP_000459883.1.70321 WP_000459883.1.70326 WP_000459883.1.70327 WP_000459883.1.70355 WP_000459883.1.7044 WP_000459883.1.70440 WP_000459883.1.70447 WP_000459883.1.70485 WP_000459883.1.70488 WP_000459883.1.70491 WP_000459883.1.70523 WP_000459883.1.70531 WP_000459883.1.70547 WP_000459883.1.7055 WP_000459883.1.70580 WP_000459883.1.70596 WP_000459883.1.7060 WP_000459883.1.70643 WP_000459883.1.70662 WP_000459883.1.70678 WP_000459883.1.70683 WP_000459883.1.70685 WP_000459883.1.70712 WP_000459883.1.70732 WP_000459883.1.70733 WP_000459883.1.70761 WP_000459883.1.70785 WP_000459883.1.70792 WP_000459883.1.70797 WP_000459883.1.70837 WP_000459883.1.70869 WP_000459883.1.70883 WP_000459883.1.70899 WP_000459883.1.70914 WP_000459883.1.70922 WP_000459883.1.70929 WP_000459883.1.7093 WP_000459883.1.70948 WP_000459883.1.70959 WP_000459883.1.70969 WP_000459883.1.70971 WP_000459883.1.70977 WP_000459883.1.70985 WP_000459883.1.70986 WP_000459883.1.71007 WP_000459883.1.71010 WP_000459883.1.71023 WP_000459883.1.71069 WP_000459883.1.71088 WP_000459883.1.7110 WP_000459883.1.71116 WP_000459883.1.71120 WP_000459883.1.71146 WP_000459883.1.71150 WP_000459883.1.71165 WP_000459883.1.71171 WP_000459883.1.71172 WP_000459883.1.71184 WP_000459883.1.71188 WP_000459883.1.71201 WP_000459883.1.71202 WP_000459883.1.71243 WP_000459883.1.71248 WP_000459883.1.71268 WP_000459883.1.71299 WP_000459883.1.71305 WP_000459883.1.71306 WP_000459883.1.71337 WP_000459883.1.7134 WP_000459883.1.71363 WP_000459883.1.71368 WP_000459883.1.71378 WP_000459883.1.714 WP_000459883.1.71401 WP_000459883.1.71407 WP_000459883.1.71418 WP_000459883.1.7142 WP_000459883.1.71446 WP_000459883.1.71450 WP_000459883.1.71452 WP_000459883.1.71481 WP_000459883.1.71500 WP_000459883.1.71583 WP_000459883.1.71600 WP_000459883.1.71626 WP_000459883.1.71636 WP_000459883.1.71649 WP_000459883.1.71656 WP_000459883.1.71667 WP_000459883.1.71691 WP_000459883.1.71702 WP_000459883.1.7174 WP_000459883.1.71746 WP_000459883.1.71750 WP_000459883.1.71756 WP_000459883.1.71798 WP_000459883.1.71845 WP_000459883.1.71848 WP_000459883.1.71881 WP_000459883.1.71908 WP_000459883.1.71923 WP_000459883.1.71929 WP_000459883.1.71941 WP_000459883.1.71952 WP_000459883.1.71973 WP_000459883.1.71979 WP_000459883.1.71984 WP_000459883.1.720 WP_000459883.1.72065 WP_000459883.1.72068 WP_000459883.1.72100 WP_000459883.1.72105 WP_000459883.1.72107 WP_000459883.1.72121 WP_000459883.1.72182 WP_000459883.1.72188 WP_000459883.1.72190 WP_000459883.1.72203 WP_000459883.1.72220 WP_000459883.1.72221 WP_000459883.1.72226 WP_000459883.1.72243 WP_000459883.1.72254 WP_000459883.1.72277 WP_000459883.1.72281 WP_000459883.1.72283 WP_000459883.1.72300 WP_000459883.1.72307 WP_000459883.1.72325 WP_000459883.1.72339 WP_000459883.1.72351 WP_000459883.1.72372 WP_000459883.1.72376 WP_000459883.1.72382 WP_000459883.1.72403 WP_000459883.1.72412 WP_000459883.1.7243 WP_000459883.1.72438 WP_000459883.1.72470 WP_000459883.1.72532 WP_000459883.1.72594 WP_000459883.1.72602 WP_000459883.1.72625 WP_000459883.1.72642 WP_000459883.1.72671 WP_000459883.1.72689 WP_000459883.1.72716 WP_000459883.1.72718 WP_000459883.1.72728 WP_000459883.1.72793 WP_000459883.1.72797 WP_000459883.1.72827 WP_000459883.1.72843 WP_000459883.1.72850 WP_000459883.1.72865 WP_000459883.1.72871 WP_000459883.1.72872 WP_000459883.1.72887 WP_000459883.1.72892 WP_000459883.1.72894 WP_000459883.1.72944 WP_000459883.1.72946 WP_000459883.1.7295 WP_000459883.1.72968 WP_000459883.1.72975 WP_000459883.1.7304 WP_000459883.1.73062 WP_000459883.1.73068 WP_000459883.1.73102 WP_000459883.1.73125 WP_000459883.1.73144 WP_000459883.1.7315 WP_000459883.1.7316 WP_000459883.1.73164 WP_000459883.1.73200 WP_000459883.1.73270 WP_000459883.1.73328 WP_000459883.1.7334 WP_000459883.1.73362 WP_000459883.1.73377 WP_000459883.1.73379 WP_000459883.1.7341 WP_000459883.1.73461 WP_000459883.1.73481 WP_000459883.1.73512 WP_000459883.1.73535 WP_000459883.1.7356 WP_000459883.1.73561 WP_000459883.1.73581 WP_000459883.1.73596 WP_000459883.1.73617 WP_000459883.1.73667 WP_000459883.1.73669 WP_000459883.1.73701 WP_000459883.1.73708 WP_000459883.1.7374 WP_000459883.1.73753 WP_000459883.1.73758 WP_000459883.1.73764 WP_000459883.1.73794 WP_000459883.1.73831 WP_000459883.1.73847 WP_000459883.1.7386 WP_000459883.1.7387 WP_000459883.1.73901 WP_000459883.1.73924 WP_000459883.1.73926 WP_000459883.1.7394 WP_000459883.1.73945 WP_000459883.1.73956 WP_000459883.1.73958 WP_000459883.1.73965 WP_000459883.1.74028 WP_000459883.1.74029 WP_000459883.1.74040 WP_000459883.1.74049 WP_000459883.1.7405 WP_000459883.1.74089 WP_000459883.1.74117 WP_000459883.1.74174 WP_000459883.1.74191 WP_000459883.1.74207 WP_000459883.1.74228 WP_000459883.1.74248 WP_000459883.1.743 WP_000459883.1.74300 WP_000459883.1.7433 WP_000459883.1.74379 WP_000459883.1.74402 WP_000459883.1.74410 WP_000459883.1.74418 WP_000459883.1.74422 WP_000459883.1.74428 WP_000459883.1.7444 WP_000459883.1.74454 WP_000459883.1.74466 WP_000459883.1.74469 WP_000459883.1.745 WP_000459883.1.74500 WP_000459883.1.74529 WP_000459883.1.74545 WP_000459883.1.74570 WP_000459883.1.74578 WP_000459883.1.7458 WP_000459883.1.74620 WP_000459883.1.74632 WP_000459883.1.74639 WP_000459883.1.74644 WP_000459883.1.74661 WP_000459883.1.74702 WP_000459883.1.74741 WP_000459883.1.74745 WP_000459883.1.74757 WP_000459883.1.74806 WP_000459883.1.74807 WP_000459883.1.74826 WP_000459883.1.74876 WP_000459883.1.74884 WP_000459883.1.7491 WP_000459883.1.74946 WP_000459883.1.74972 WP_000459883.1.74992 WP_000459883.1.74996 WP_000459883.1.75009 WP_000459883.1.75051 WP_000459883.1.75056 WP_000459883.1.75114 WP_000459883.1.75129 WP_000459883.1.75134 WP_000459883.1.75148 WP_000459883.1.75159 WP_000459883.1.75168 WP_000459883.1.75177 WP_000459883.1.75180 WP_000459883.1.75187 WP_000459883.1.75288 WP_000459883.1.75301 WP_000459883.1.7531 WP_000459883.1.75334 WP_000459883.1.75362 WP_000459883.1.75371 WP_000459883.1.75385 WP_000459883.1.75392 WP_000459883.1.75400 WP_000459883.1.75402 WP_000459883.1.7543 WP_000459883.1.75450 WP_000459883.1.75494 WP_000459883.1.7558 WP_000459883.1.75585 WP_000459883.1.75607 WP_000459883.1.75609 WP_000459883.1.75626 WP_000459883.1.75664 WP_000459883.1.75703 WP_000459883.1.75716 WP_000459883.1.75740 WP_000459883.1.75751 WP_000459883.1.75760 WP_000459883.1.75764 WP_000459883.1.75793 WP_000459883.1.75794 WP_000459883.1.75810 WP_000459883.1.75828 WP_000459883.1.75837 WP_000459883.1.75863 WP_000459883.1.75873 WP_000459883.1.75874 WP_000459883.1.75884 WP_000459883.1.75902 WP_000459883.1.75932 WP_000459883.1.75945 WP_000459883.1.75957 WP_000459883.1.76 WP_000459883.1.76020 WP_000459883.1.76024 WP_000459883.1.76055 WP_000459883.1.76097 WP_000459883.1.76102 WP_000459883.1.76108 WP_000459883.1.76115 WP_000459883.1.76137 WP_000459883.1.76156 WP_000459883.1.76162 WP_000459883.1.76164 WP_000459883.1.76170 WP_000459883.1.76186 WP_000459883.1.76197 WP_000459883.1.76208 WP_000459883.1.76252 WP_000459883.1.7629 WP_000459883.1.76301 WP_000459883.1.76327 WP_000459883.1.7633 WP_000459883.1.7634 WP_000459883.1.76345 WP_000459883.1.76346 WP_000459883.1.76364 WP_000459883.1.76434 WP_000459883.1.76445 WP_000459883.1.76451 WP_000459883.1.76471 WP_000459883.1.76495 WP_000459883.1.76529 WP_000459883.1.76532 WP_000459883.1.76548 WP_000459883.1.7655 WP_000459883.1.7657 WP_000459883.1.76576 WP_000459883.1.7660 WP_000459883.1.76611 WP_000459883.1.76673 WP_000459883.1.76706 WP_000459883.1.7672 WP_000459883.1.76721 WP_000459883.1.76724 WP_000459883.1.76738 WP_000459883.1.76756 WP_000459883.1.76760 WP_000459883.1.76776 WP_000459883.1.76799 WP_000459883.1.76806 WP_000459883.1.7684 WP_000459883.1.76875 WP_000459883.1.76880 WP_000459883.1.76899 WP_000459883.1.76913 WP_000459883.1.76968 WP_000459883.1.77033 WP_000459883.1.77038 WP_000459883.1.77047 WP_000459883.1.77067 WP_000459883.1.77080 WP_000459883.1.7712 WP_000459883.1.77177 WP_000459883.1.77180 WP_000459883.1.77184 WP_000459883.1.77193 WP_000459883.1.77241 WP_000459883.1.77244 WP_000459883.1.77267 WP_000459883.1.77271 WP_000459883.1.77292 WP_000459883.1.77306 WP_000459883.1.77313 WP_000459883.1.77349 WP_000459883.1.77356 WP_000459883.1.77390 WP_000459883.1.77414 WP_000459883.1.77431 WP_000459883.1.77436 WP_000459883.1.77440 WP_000459883.1.77475 WP_000459883.1.77496 WP_000459883.1.77514 WP_000459883.1.77529 WP_000459883.1.77543 WP_000459883.1.77549 WP_000459883.1.77555 WP_000459883.1.77565 WP_000459883.1.77575 WP_000459883.1.77596 WP_000459883.1.77629 WP_000459883.1.77646 WP_000459883.1.77653 WP_000459883.1.77692 WP_000459883.1.77710 WP_000459883.1.77729 WP_000459883.1.77754 WP_000459883.1.77761 WP_000459883.1.7782 WP_000459883.1.7784 WP_000459883.1.77846 WP_000459883.1.77851 WP_000459883.1.77898 WP_000459883.1.77918 WP_000459883.1.7792 WP_000459883.1.7793 WP_000459883.1.77951 WP_000459883.1.77960 WP_000459883.1.77983 WP_000459883.1.77987 WP_000459883.1.77989 WP_000459883.1.78016 WP_000459883.1.7802 WP_000459883.1.78026 WP_000459883.1.78033 WP_000459883.1.78051 WP_000459883.1.78053 WP_000459883.1.78076 WP_000459883.1.78096 WP_000459883.1.78100 WP_000459883.1.78110 WP_000459883.1.78120 WP_000459883.1.7814 WP_000459883.1.78168 WP_000459883.1.78170 WP_000459883.1.78180 WP_000459883.1.78201 WP_000459883.1.78245 WP_000459883.1.78259 WP_000459883.1.78301 WP_000459883.1.78339 WP_000459883.1.78352 WP_000459883.1.78366 WP_000459883.1.78372 WP_000459883.1.78383 WP_000459883.1.78407 WP_000459883.1.78443 WP_000459883.1.78495 WP_000459883.1.78496 WP_000459883.1.78501 WP_000459883.1.78502 WP_000459883.1.78602 WP_000459883.1.78603 WP_000459883.1.7861 WP_000459883.1.78618 WP_000459883.1.78632 WP_000459883.1.78658 WP_000459883.1.78673 WP_000459883.1.78697 WP_000459883.1.78734 WP_000459883.1.78735 WP_000459883.1.78738 WP_000459883.1.7877 WP_000459883.1.78771 WP_000459883.1.78789 WP_000459883.1.78802 WP_000459883.1.78815 WP_000459883.1.78830 WP_000459883.1.78835 WP_000459883.1.78838 WP_000459883.1.78862 WP_000459883.1.78871 WP_000459883.1.78874 WP_000459883.1.78877 WP_000459883.1.78881 WP_000459883.1.78896 WP_000459883.1.7891 WP_000459883.1.78913 WP_000459883.1.78918 WP_000459883.1.78928 WP_000459883.1.7893 WP_000459883.1.78930 WP_000459883.1.78951 WP_000459883.1.78959 WP_000459883.1.79011 WP_000459883.1.79032 WP_000459883.1.79081 WP_000459883.1.79099 WP_000459883.1.79140 WP_000459883.1.79151 WP_000459883.1.79167 WP_000459883.1.79189 WP_000459883.1.79203 WP_000459883.1.79235 WP_000459883.1.79289 WP_000459883.1.79297 WP_000459883.1.79302 WP_000459883.1.79335 WP_000459883.1.79427 WP_000459883.1.79462 WP_000459883.1.79466 WP_000459883.1.79468 WP_000459883.1.79472 WP_000459883.1.79490 WP_000459883.1.79495 WP_000459883.1.79529 WP_000459883.1.79531 WP_000459883.1.7956 WP_000459883.1.79570 WP_000459883.1.79580 WP_000459883.1.79586 WP_000459883.1.79635 WP_000459883.1.7964 WP_000459883.1.79642 WP_000459883.1.79645 WP_000459883.1.79659 WP_000459883.1.79668 WP_000459883.1.79708 WP_000459883.1.7972 WP_000459883.1.79734 WP_000459883.1.79757 WP_000459883.1.79778 WP_000459883.1.7979 WP_000459883.1.7982 WP_000459883.1.79832 WP_000459883.1.79845 WP_000459883.1.79867 WP_000459883.1.79892 WP_000459883.1.7991 WP_000459883.1.79910 WP_000459883.1.79914 WP_000459883.1.79929 WP_000459883.1.79934 WP_000459883.1.79942 WP_000459883.1.79945 WP_000459883.1.79951 WP_000459883.1.79966 WP_000459883.1.79974 WP_000459883.1.79977 WP_000459883.1.80045 WP_000459883.1.80077 WP_000459883.1.80137 WP_000459883.1.80149 WP_000459883.1.80182 WP_000459883.1.80229 WP_000459883.1.80236 WP_000459883.1.8024 WP_000459883.1.80249 WP_000459883.1.80250 WP_000459883.1.80254 WP_000459883.1.80293 WP_000459883.1.80296 WP_000459883.1.80307 WP_000459883.1.80333 WP_000459883.1.80366 WP_000459883.1.80380 WP_000459883.1.80441 WP_000459883.1.80443 WP_000459883.1.80448 WP_000459883.1.80473 WP_000459883.1.80479 WP_000459883.1.80480 WP_000459883.1.80496 WP_000459883.1.80529 WP_000459883.1.80542 WP_000459883.1.80586 WP_000459883.1.80609 WP_000459883.1.80629 WP_000459883.1.80638 WP_000459883.1.80651 WP_000459883.1.80667 WP_000459883.1.80674 WP_000459883.1.80707 WP_000459883.1.80723 WP_000459883.1.80725 WP_000459883.1.80741 WP_000459883.1.80750 WP_000459883.1.80760 WP_000459883.1.80780 WP_000459883.1.80803 WP_000459883.1.80819 WP_000459883.1.80827 WP_000459883.1.80831 WP_000459883.1.80840 WP_000459883.1.80850 WP_000459883.1.80857 WP_000459883.1.80868 WP_000459883.1.80874 WP_000459883.1.80876 WP_000459883.1.80881 WP_000459883.1.80913 WP_000459883.1.80927 WP_000459883.1.80939 WP_000459883.1.80959 WP_000459883.1.8096 WP_000459883.1.80973 WP_000459883.1.81037 WP_000459883.1.81041 WP_000459883.1.8106 WP_000459883.1.81062 WP_000459883.1.81067 WP_000459883.1.81069 WP_000459883.1.81084 WP_000459883.1.81107 WP_000459883.1.81109 WP_000459883.1.81110 WP_000459883.1.81118 WP_000459883.1.81149 WP_000459883.1.81175 WP_000459883.1.8119 WP_000459883.1.81193 WP_000459883.1.81197 WP_000459883.1.81225 WP_000459883.1.81231 WP_000459883.1.8127 WP_000459883.1.81275 WP_000459883.1.8130 WP_000459883.1.81302 WP_000459883.1.81305 WP_000459883.1.81320 WP_000459883.1.81321 WP_000459883.1.81328 WP_000459883.1.8134 WP_000459883.1.81354 WP_000459883.1.81388 WP_000459883.1.81409 WP_000459883.1.81410 WP_000459883.1.81425 WP_000459883.1.81455 WP_000459883.1.81472 WP_000459883.1.81504 WP_000459883.1.81528 WP_000459883.1.81548 WP_000459883.1.81568 WP_000459883.1.81667 WP_000459883.1.81668 WP_000459883.1.8168 WP_000459883.1.81727 WP_000459883.1.81735 WP_000459883.1.81736 WP_000459883.1.81743 WP_000459883.1.81746 WP_000459883.1.81750 WP_000459883.1.81760 WP_000459883.1.81768 WP_000459883.1.81785 WP_000459883.1.81795 WP_000459883.1.81798 WP_000459883.1.81902 WP_000459883.1.8196 WP_000459883.1.81965 WP_000459883.1.81974 WP_000459883.1.81977 WP_000459883.1.81995 WP_000459883.1.82037 WP_000459883.1.82099 WP_000459883.1.82141 WP_000459883.1.82144 WP_000459883.1.82149 WP_000459883.1.82192 WP_000459883.1.82232 WP_000459883.1.82258 WP_000459883.1.82269 WP_000459883.1.82337 WP_000459883.1.82347 WP_000459883.1.82352 WP_000459883.1.8236 WP_000459883.1.82369 WP_000459883.1.82395 WP_000459883.1.82401 WP_000459883.1.82420 WP_000459883.1.82434 WP_000459883.1.82464 WP_000459883.1.8247 WP_000459883.1.82474 WP_000459883.1.82479 WP_000459883.1.82503 WP_000459883.1.82515 WP_000459883.1.82529 WP_000459883.1.82530 WP_000459883.1.82562 WP_000459883.1.82569 WP_000459883.1.82570 WP_000459883.1.82584 WP_000459883.1.82636 WP_000459883.1.82637 WP_000459883.1.82648 WP_000459883.1.82676 WP_000459883.1.82761 WP_000459883.1.82763 WP_000459883.1.8282 WP_000459883.1.82841 WP_000459883.1.82843 WP_000459883.1.82867 WP_000459883.1.82886 WP_000459883.1.82895 WP_000459883.1.82899 WP_000459883.1.82908 WP_000459883.1.82937 WP_000459883.1.82944 WP_000459883.1.82946 WP_000459883.1.82956 WP_000459883.1.82992 WP_000459883.1.83005 WP_000459883.1.83006 WP_000459883.1.83061 WP_000459883.1.83092 WP_000459883.1.83119 WP_000459883.1.83128 WP_000459883.1.83139 WP_000459883.1.83163 WP_000459883.1.83204 WP_000459883.1.8322 WP_000459883.1.83221 WP_000459883.1.83247 WP_000459883.1.83252 WP_000459883.1.83258 WP_000459883.1.83280 WP_000459883.1.83301 WP_000459883.1.83305 WP_000459883.1.83331 WP_000459883.1.83354 WP_000459883.1.83356 WP_000459883.1.83360 WP_000459883.1.83365 WP_000459883.1.83378 WP_000459883.1.83382 WP_000459883.1.83388 WP_000459883.1.83407 WP_000459883.1.83413 WP_000459883.1.83491 WP_000459883.1.83510 WP_000459883.1.83516 WP_000459883.1.83523 WP_000459883.1.8354 WP_000459883.1.83558 WP_000459883.1.83572 WP_000459883.1.83598 WP_000459883.1.83650 WP_000459883.1.83651 WP_000459883.1.83710 WP_000459883.1.83721 WP_000459883.1.83739 WP_000459883.1.83759 WP_000459883.1.83760 WP_000459883.1.83806 WP_000459883.1.83854 WP_000459883.1.83897 WP_000459883.1.83960 WP_000459883.1.83979 WP_000459883.1.8399 WP_000459883.1.83995 WP_000459883.1.84000 WP_000459883.1.84001 WP_000459883.1.84011 WP_000459883.1.84031 WP_000459883.1.84075 WP_000459883.1.84077 WP_000459883.1.84083 WP_000459883.1.84086 WP_000459883.1.84100 WP_000459883.1.84103 WP_000459883.1.84106 WP_000459883.1.84115 WP_000459883.1.84154 WP_000459883.1.84168 WP_000459883.1.84179 WP_000459883.1.84198 WP_000459883.1.84205 WP_000459883.1.84209 WP_000459883.1.84229 WP_000459883.1.8425 WP_000459883.1.84283 WP_000459883.1.84291 WP_000459883.1.84300 WP_000459883.1.84325 WP_000459883.1.84355 WP_000459883.1.84359 WP_000459883.1.84392 WP_000459883.1.84397 WP_000459883.1.84403 WP_000459883.1.8441 WP_000459883.1.84461 WP_000459883.1.84475 WP_000459883.1.84497 WP_000459883.1.84515 WP_000459883.1.84523 WP_000459883.1.84532 WP_000459883.1.84551 WP_000459883.1.84554 WP_000459883.1.84572 WP_000459883.1.84598 WP_000459883.1.84659 WP_000459883.1.84683 WP_000459883.1.84693 WP_000459883.1.84711 WP_000459883.1.84721 WP_000459883.1.84745 WP_000459883.1.84814 WP_000459883.1.84872 WP_000459883.1.84876 WP_000459883.1.84879 WP_000459883.1.84899 WP_000459883.1.849 WP_000459883.1.8497 WP_000459883.1.84983 WP_000459883.1.850 WP_000459883.1.85014 WP_000459883.1.85031 WP_000459883.1.85040 WP_000459883.1.85079 WP_000459883.1.85094 WP_000459883.1.85120 WP_000459883.1.85126 WP_000459883.1.85134 WP_000459883.1.85147 WP_000459883.1.85178 WP_000459883.1.85180 WP_000459883.1.85190 WP_000459883.1.85192 WP_000459883.1.85217 WP_000459883.1.8526 WP_000459883.1.85271 WP_000459883.1.85301 WP_000459883.1.8533 WP_000459883.1.85408 WP_000459883.1.85433 WP_000459883.1.8545 WP_000459883.1.85469 WP_000459883.1.85481 WP_000459883.1.85483 WP_000459883.1.8552 WP_000459883.1.85541 WP_000459883.1.8556 WP_000459883.1.85568 WP_000459883.1.85615 WP_000459883.1.85617 WP_000459883.1.85654 WP_000459883.1.85663 WP_000459883.1.85671 WP_000459883.1.85672 WP_000459883.1.85675 WP_000459883.1.85723 WP_000459883.1.85742 WP_000459883.1.85759 WP_000459883.1.85777 WP_000459883.1.85784 WP_000459883.1.85797 WP_000459883.1.85854 WP_000459883.1.85855 WP_000459883.1.85864 WP_000459883.1.85886 WP_000459883.1.85900 WP_000459883.1.85904 WP_000459883.1.8591 WP_000459883.1.85943 WP_000459883.1.85976 WP_000459883.1.85982 WP_000459883.1.86007 WP_000459883.1.86010 WP_000459883.1.86017 WP_000459883.1.86043 WP_000459883.1.86092 WP_000459883.1.86120 WP_000459883.1.86126 WP_000459883.1.86138 WP_000459883.1.86157 WP_000459883.1.86159 WP_000459883.1.8616 WP_000459883.1.86173 WP_000459883.1.86206 WP_000459883.1.86240 WP_000459883.1.86259 WP_000459883.1.86284 WP_000459883.1.86285 WP_000459883.1.86306 WP_000459883.1.86310 WP_000459883.1.86316 WP_000459883.1.86335 WP_000459883.1.86347 WP_000459883.1.86356 WP_000459883.1.86380 WP_000459883.1.86389 WP_000459883.1.86442 WP_000459883.1.86450 WP_000459883.1.86453 WP_000459883.1.86466 WP_000459883.1.86469 WP_000459883.1.8647 WP_000459883.1.86514 WP_000459883.1.86580 WP_000459883.1.86588 WP_000459883.1.86601 WP_000459883.1.86610 WP_000459883.1.86634 WP_000459883.1.86656 WP_000459883.1.86658 WP_000459883.1.86661 WP_000459883.1.86676 WP_000459883.1.86699 WP_000459883.1.8671 WP_000459883.1.8672 WP_000459883.1.86735 WP_000459883.1.86744 WP_000459883.1.8678 WP_000459883.1.86807 WP_000459883.1.86810 WP_000459883.1.8684 WP_000459883.1.86859 WP_000459883.1.86860 WP_000459883.1.86895 WP_000459883.1.86902 WP_000459883.1.86906 WP_000459883.1.8691 WP_000459883.1.86915 WP_000459883.1.86921 WP_000459883.1.86982 WP_000459883.1.87038 WP_000459883.1.87051 WP_000459883.1.87095 WP_000459883.1.87143 WP_000459883.1.87148 WP_000459883.1.87187 WP_000459883.1.87219 WP_000459883.1.8722 WP_000459883.1.87220 WP_000459883.1.87265 WP_000459883.1.87276 WP_000459883.1.87282 WP_000459883.1.87283 WP_000459883.1.87323 WP_000459883.1.87346 WP_000459883.1.8736 WP_000459883.1.87370 WP_000459883.1.87376 WP_000459883.1.87460 WP_000459883.1.87484 WP_000459883.1.87493 WP_000459883.1.87500 WP_000459883.1.87552 WP_000459883.1.87583 WP_000459883.1.87584 WP_000459883.1.87618 WP_000459883.1.87626 WP_000459883.1.87651 WP_000459883.1.8767 WP_000459883.1.87687 WP_000459883.1.87695 WP_000459883.1.87712 WP_000459883.1.87760 WP_000459883.1.87779 WP_000459883.1.87813 WP_000459883.1.87875 WP_000459883.1.87891 WP_000459883.1.87899 WP_000459883.1.87905 WP_000459883.1.8792 WP_000459883.1.87933 WP_000459883.1.87936 WP_000459883.1.87945 WP_000459883.1.87999 WP_000459883.1.8800 WP_000459883.1.88014 WP_000459883.1.88019 WP_000459883.1.88052 WP_000459883.1.88073 WP_000459883.1.8809 WP_000459883.1.88092 WP_000459883.1.88136 WP_000459883.1.88165 WP_000459883.1.88174 WP_000459883.1.88185 WP_000459883.1.88214 WP_000459883.1.88222 WP_000459883.1.88244 WP_000459883.1.88275 WP_000459883.1.88291 WP_000459883.1.88293 WP_000459883.1.88303 WP_000459883.1.88356 WP_000459883.1.8837 WP_000459883.1.88393 WP_000459883.1.88423 WP_000459883.1.88474 WP_000459883.1.88483 WP_000459883.1.88508 WP_000459883.1.88597 WP_000459883.1.88609 WP_000459883.1.88620 WP_000459883.1.88624 WP_000459883.1.88651 WP_000459883.1.88675 WP_000459883.1.88683 WP_000459883.1.88698 WP_000459883.1.88703 WP_000459883.1.88731 WP_000459883.1.88762 WP_000459883.1.88776 WP_000459883.1.88792 WP_000459883.1.88817 WP_000459883.1.88845 WP_000459883.1.88854 WP_000459883.1.88902 WP_000459883.1.8891 WP_000459883.1.88942 WP_000459883.1.88957 WP_000459883.1.88966 WP_000459883.1.88967 WP_000459883.1.88968 WP_000459883.1.88970 WP_000459883.1.88980 WP_000459883.1.88981 WP_000459883.1.88982 WP_000459883.1.88995 WP_000459883.1.88998 WP_000459883.1.89008 WP_000459883.1.89054 WP_000459883.1.89114 WP_000459883.1.89116 WP_000459883.1.89119 WP_000459883.1.89120 WP_000459883.1.89138 WP_000459883.1.89174 WP_000459883.1.89177 WP_000459883.1.89188 WP_000459883.1.89215 WP_000459883.1.89221 WP_000459883.1.89291 WP_000459883.1.89304 WP_000459883.1.89311 WP_000459883.1.89354 WP_000459883.1.89355 WP_000459883.1.89362 WP_000459883.1.89408 WP_000459883.1.89425 WP_000459883.1.89452 WP_000459883.1.89462 WP_000459883.1.89512 WP_000459883.1.89527 WP_000459883.1.89570 WP_000459883.1.8958 WP_000459883.1.89580 WP_000459883.1.89604 WP_000459883.1.89606 WP_000459883.1.8961 WP_000459883.1.89622 WP_000459883.1.89632 WP_000459883.1.89634 WP_000459883.1.89647 WP_000459883.1.89657 WP_000459883.1.89659 WP_000459883.1.89680 WP_000459883.1.89746 WP_000459883.1.89764 WP_000459883.1.89765 WP_000459883.1.89777 WP_000459883.1.89815 WP_000459883.1.89817 WP_000459883.1.89832 WP_000459883.1.89902 WP_000459883.1.89914 WP_000459883.1.89940 WP_000459883.1.8996 WP_000459883.1.89965 WP_000459883.1.89975 WP_000459883.1.9002 WP_000459883.1.9003 WP_000459883.1.90033 WP_000459883.1.90084 WP_000459883.1.90097 WP_000459883.1.90108 WP_000459883.1.90193 WP_000459883.1.90211 WP_000459883.1.90220 WP_000459883.1.90248 WP_000459883.1.90252 WP_000459883.1.90293 WP_000459883.1.90311 WP_000459883.1.90348 WP_000459883.1.90363 WP_000459883.1.90409 WP_000459883.1.90417 WP_000459883.1.90421 WP_000459883.1.90440 WP_000459883.1.90453 WP_000459883.1.90458 WP_000459883.1.90521 WP_000459883.1.90522 WP_000459883.1.90540 WP_000459883.1.90557 WP_000459883.1.90563 WP_000459883.1.90566 WP_000459883.1.90585 WP_000459883.1.90620 WP_000459883.1.90625 WP_000459883.1.9064 WP_000459883.1.90641 WP_000459883.1.90686 WP_000459883.1.90701 WP_000459883.1.90734 WP_000459883.1.90748 WP_000459883.1.90759 WP_000459883.1.90792 WP_000459883.1.90859 WP_000459883.1.90866 WP_000459883.1.90876 WP_000459883.1.90878 WP_000459883.1.9089 WP_000459883.1.90959 WP_000459883.1.90973 WP_000459883.1.90983 WP_000459883.1.90984 WP_000459883.1.90991 WP_000459883.1.91003 WP_000459883.1.91023 WP_000459883.1.91042 WP_000459883.1.91049 WP_000459883.1.91056 WP_000459883.1.91069 WP_000459883.1.91107 WP_000459883.1.91179 WP_000459883.1.91215 WP_000459883.1.91278 WP_000459883.1.91282 WP_000459883.1.9131 WP_000459883.1.91312 WP_000459883.1.91331 WP_000459883.1.91334 WP_000459883.1.9137 WP_000459883.1.91372 WP_000459883.1.91381 WP_000459883.1.91424 WP_000459883.1.91453 WP_000459883.1.91459 WP_000459883.1.91470 WP_000459883.1.91473 WP_000459883.1.91474 WP_000459883.1.91493 WP_000459883.1.91505 WP_000459883.1.91512 WP_000459883.1.91524 WP_000459883.1.91528 WP_000459883.1.91564 WP_000459883.1.91579 WP_000459883.1.91580 WP_000459883.1.91621 WP_000459883.1.91625 WP_000459883.1.91628 WP_000459883.1.91655 WP_000459883.1.9166 WP_000459883.1.91702 WP_000459883.1.91724 WP_000459883.1.91732 WP_000459883.1.91736 WP_000459883.1.91742 WP_000459883.1.91772 WP_000459883.1.91776 WP_000459883.1.91788 WP_000459883.1.91795 WP_000459883.1.91806 WP_000459883.1.91864 WP_000459883.1.91880 WP_000459883.1.91898 WP_000459883.1.91903 WP_000459883.1.91904 WP_000459883.1.91914 WP_000459883.1.91974 WP_000459883.1.91984 WP_000459883.1.92013 WP_000459883.1.92039 WP_000459883.1.92044 WP_000459883.1.92047 WP_000459883.1.92060 WP_000459883.1.92067 WP_000459883.1.92068 WP_000459883.1.92082 WP_000459883.1.92093 WP_000459883.1.92099 WP_000459883.1.92108 WP_000459883.1.92129 WP_000459883.1.92149 WP_000459883.1.92165 WP_000459883.1.92171 WP_000459883.1.92183 WP_000459883.1.92208 WP_000459883.1.92213 WP_000459883.1.9222 WP_000459883.1.92268 WP_000459883.1.92270 WP_000459883.1.92299 WP_000459883.1.92310 WP_000459883.1.92318 WP_000459883.1.92375 WP_000459883.1.92394 WP_000459883.1.92399 WP_000459883.1.92411 WP_000459883.1.92439 WP_000459883.1.92443 WP_000459883.1.92452 WP_000459883.1.92482 WP_000459883.1.92529 WP_000459883.1.9253 WP_000459883.1.92531 WP_000459883.1.92557 WP_000459883.1.92575 WP_000459883.1.92628 WP_000459883.1.92646 WP_000459883.1.92659 WP_000459883.1.92669 WP_000459883.1.92671 WP_000459883.1.92729 WP_000459883.1.92738 WP_000459883.1.92754 WP_000459883.1.92758 WP_000459883.1.92786 WP_000459883.1.92806 WP_000459883.1.92827 WP_000459883.1.92836 WP_000459883.1.92842 WP_000459883.1.92843 WP_000459883.1.92875 WP_000459883.1.92879 WP_000459883.1.92883 WP_000459883.1.92890 WP_000459883.1.92893 WP_000459883.1.92895 WP_000459883.1.92926 WP_000459883.1.92929 WP_000459883.1.92936 WP_000459883.1.92939 WP_000459883.1.92975 WP_000459883.1.92988 WP_000459883.1.93059 WP_000459883.1.93061 WP_000459883.1.93076 WP_000459883.1.93086 WP_000459883.1.93101 WP_000459883.1.93118 WP_000459883.1.93136 WP_000459883.1.93155 WP_000459883.1.93213 WP_000459883.1.93215 WP_000459883.1.93275 WP_000459883.1.93322 WP_000459883.1.93339 WP_000459883.1.93350 WP_000459883.1.93365 WP_000459883.1.93376 WP_000459883.1.93410 WP_000459883.1.93524 WP_000459883.1.93543 WP_000459883.1.93577 WP_000459883.1.93596 WP_000459883.1.93604 WP_000459883.1.93648 WP_000459883.1.93650 WP_000459883.1.93656 WP_000459883.1.93662 WP_000459883.1.93671 WP_000459883.1.93691 WP_000459883.1.937 WP_000459883.1.93705 WP_000459883.1.93741 WP_000459883.1.93761 WP_000459883.1.93767 WP_000459883.1.9380 WP_000459883.1.93803 WP_000459883.1.93804 WP_000459883.1.93809 WP_000459883.1.93837 WP_000459883.1.9389 WP_000459883.1.93937 WP_000459883.1.93956 WP_000459883.1.93986 WP_000459883.1.93994 WP_000459883.1.94039 WP_000459883.1.94056 WP_000459883.1.94064 WP_000459883.1.94070 WP_000459883.1.94071 WP_000459883.1.94072 WP_000459883.1.94132 WP_000459883.1.94162 WP_000459883.1.94167 WP_000459883.1.94168 WP_000459883.1.94181 WP_000459883.1.94198 WP_000459883.1.9432 WP_000459883.1.94352 WP_000459883.1.94354 WP_000459883.1.94379 WP_000459883.1.94380 WP_000459883.1.94383 WP_000459883.1.9440 WP_000459883.1.94412 WP_000459883.1.94458 WP_000459883.1.94473 WP_000459883.1.94557 WP_000459883.1.94562 WP_000459883.1.94565 WP_000459883.1.94584 WP_000459883.1.94588 WP_000459883.1.94598 WP_000459883.1.9463 WP_000459883.1.94649 WP_000459883.1.94655 WP_000459883.1.94669 WP_000459883.1.94670 WP_000459883.1.94674 WP_000459883.1.94717 WP_000459883.1.94722 WP_000459883.1.94785 WP_000459883.1.94796 WP_000459883.1.94798 WP_000459883.1.94817 WP_000459883.1.94835 WP_000459883.1.94849 WP_000459883.1.94862 WP_000459883.1.94947 WP_000459883.1.94959 WP_000459883.1.94967 WP_000459883.1.94971 WP_000459883.1.94982 WP_000459883.1.94983 WP_000459883.1.94986 WP_000459883.1.94987 WP_000459883.1.9503 WP_000459883.1.95051 WP_000459883.1.95085 WP_000459883.1.95094 WP_000459883.1.95121 WP_000459883.1.95133 WP_000459883.1.95136 WP_000459883.1.95152 WP_000459883.1.9516 WP_000459883.1.95171 WP_000459883.1.95235 WP_000459883.1.95248 WP_000459883.1.95249 WP_000459883.1.9527 WP_000459883.1.95277 WP_000459883.1.95282 WP_000459883.1.95289 WP_000459883.1.95298 WP_000459883.1.9530 WP_000459883.1.95320 WP_000459883.1.95388 WP_000459883.1.95404 WP_000459883.1.95434 WP_000459883.1.95447 WP_000459883.1.95456 WP_000459883.1.95465 WP_000459883.1.95546 WP_000459883.1.95558 WP_000459883.1.95579 WP_000459883.1.95607 WP_000459883.1.95623 WP_000459883.1.95630 WP_000459883.1.95641 WP_000459883.1.95656 WP_000459883.1.95670 WP_000459883.1.95691 WP_000459883.1.95701 WP_000459883.1.95729 WP_000459883.1.9574 WP_000459883.1.95744 WP_000459883.1.95757 WP_000459883.1.95803 WP_000459883.1.95805 WP_000459883.1.95826 WP_000459883.1.95840 WP_000459883.1.9586 WP_000459883.1.95866 WP_000459883.1.95901 WP_000459883.1.95911 WP_000459883.1.95939 WP_000459883.1.95940 WP_000459883.1.95963 WP_000459883.1.96004 WP_000459883.1.96042 WP_000459883.1.96045 WP_000459883.1.9609 WP_000459883.1.96107 WP_000459883.1.96139 WP_000459883.1.96141 WP_000459883.1.96162 WP_000459883.1.96190 WP_000459883.1.96203 WP_000459883.1.96206 WP_000459883.1.9624 WP_000459883.1.9627 WP_000459883.1.9628 WP_000459883.1.96317 WP_000459883.1.96335 WP_000459883.1.96340 WP_000459883.1.96343 WP_000459883.1.96348 WP_000459883.1.96349 WP_000459883.1.96380 WP_000459883.1.96404 WP_000459883.1.96429 WP_000459883.1.9644 WP_000459883.1.96469 WP_000459883.1.96490 WP_000459883.1.96497 WP_000459883.1.96500 WP_000459883.1.96521 WP_000459883.1.96533 WP_000459883.1.96537 WP_000459883.1.96555 WP_000459883.1.96563 WP_000459883.1.96584 WP_000459883.1.96588 WP_000459883.1.96590 WP_000459883.1.96600 WP_000459883.1.96640 WP_000459883.1.96642 WP_000459883.1.96662 WP_000459883.1.96721 WP_000459883.1.96731 WP_000459883.1.96732 WP_000459883.1.96735 WP_000459883.1.9674 WP_000459883.1.96758 WP_000459883.1.96761 WP_000459883.1.96771 WP_000459883.1.96798 WP_000459883.1.96810 WP_000459883.1.9686 WP_000459883.1.96876 WP_000459883.1.96890 WP_000459883.1.96902 WP_000459883.1.96917 WP_000459883.1.96993 WP_000459883.1.97005 WP_000459883.1.97015 WP_000459883.1.97043 WP_000459883.1.97047 WP_000459883.1.97089 WP_000459883.1.97109 WP_000459883.1.97143 WP_000459883.1.97145 WP_000459883.1.97185 WP_000459883.1.97190 WP_000459883.1.97224 WP_000459883.1.97260 WP_000459883.1.97297 WP_000459883.1.97318 WP_000459883.1.97322 WP_000459883.1.97328 WP_000459883.1.97337 WP_000459883.1.97368 WP_000459883.1.97369 WP_000459883.1.97386 WP_000459883.1.97413 WP_000459883.1.97477 WP_000459883.1.97480 WP_000459883.1.97487 WP_000459883.1.97496 WP_000459883.1.97534 WP_000459883.1.97547 WP_000459883.1.97597 WP_000459883.1.97613 WP_000459883.1.97620 WP_000459883.1.97626 WP_000459883.1.97628 WP_000459883.1.97631 WP_000459883.1.97648 WP_000459883.1.97656 WP_000459883.1.97691 WP_000459883.1.97693 WP_000459883.1.97704 WP_000459883.1.97725 WP_000459883.1.97727 WP_000459883.1.97732 WP_000459883.1.97736 WP_000459883.1.9774 WP_000459883.1.9775 WP_000459883.1.97768 WP_000459883.1.97772 WP_000459883.1.97800 WP_000459883.1.97846 WP_000459883.1.97873 WP_000459883.1.97907 WP_000459883.1.9793 WP_000459883.1.97981 WP_000459883.1.97983 WP_000459883.1.9799 WP_000459883.1.97991 WP_000459883.1.98006 WP_000459883.1.98019 WP_000459883.1.98022 WP_000459883.1.9805 WP_000459883.1.98107 WP_000459883.1.9811 WP_000459883.1.98110 WP_000459883.1.98119 WP_000459883.1.98146 WP_000459883.1.98170 WP_000459883.1.98201 WP_000459883.1.98219 WP_000459883.1.98236 WP_000459883.1.98250 WP_000459883.1.9826 WP_000459883.1.98314 WP_000459883.1.98338 WP_000459883.1.98392 WP_000459883.1.98402 WP_000459883.1.98403 WP_000459883.1.9841 WP_000459883.1.98438 WP_000459883.1.98440 WP_000459883.1.98446 WP_000459883.1.98472 WP_000459883.1.98483 WP_000459883.1.98495 WP_000459883.1.98513 WP_000459883.1.98531 WP_000459883.1.98551 WP_000459883.1.98570 WP_000459883.1.98577 WP_000459883.1.98608 WP_000459883.1.98627 WP_000459883.1.9863 WP_000459883.1.98634 WP_000459883.1.98676 WP_000459883.1.98677 WP_000459883.1.98726 WP_000459883.1.98751 WP_000459883.1.98760 WP_000459883.1.98763 WP_000459883.1.98779 WP_000459883.1.98843 WP_000459883.1.9887 WP_000459883.1.98899 WP_000459883.1.98931 WP_000459883.1.98947 WP_000459883.1.9898 WP_000459883.1.9899 WP_000459883.1.99040 WP_000459883.1.99057 WP_000459883.1.99071 WP_000459883.1.99072 WP_000459883.1.99073 WP_000459883.1.99083 WP_000459883.1.99097 WP_000459883.1.99098 WP_000459883.1.99107 WP_000459883.1.99164 WP_000459883.1.99184 WP_000459883.1.9919 WP_000459883.1.99197 WP_000459883.1.99198 WP_000459883.1.99215 WP_000459883.1.99219 WP_000459883.1.99255 WP_000459883.1.99267 WP_000459883.1.99276 WP_000459883.1.99278 WP_000459883.1.99327 WP_000459883.1.99339 WP_000459883.1.99370 WP_000459883.1.99426 WP_000459883.1.99456 WP_000459883.1.99469 WP_000459883.1.99490 WP_000459883.1.99493 WP_000459883.1.99531 WP_000459883.1.9954 WP_000459883.1.99577 WP_000459883.1.99613 WP_000459883.1.99626 WP_000459883.1.99630 WP_000459883.1.99637 WP_000459883.1.99646 WP_000459883.1.99657 WP_000459883.1.99660 WP_000459883.1.99712 WP_000459883.1.99725 WP_000459883.1.99783 WP_000459883.1.99813 WP_000459883.1.99824 WP_000459883.1.99858 WP_000459883.1.99889 WP_000459883.1.99924 WP_000459883.1.99958 WP_000459883.1.99961 gi|525857450|ref|YP_008260505.1| gi|525826866|ref|YP_008249347.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]