SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384454201|ref|YP_005666796.1| from Chlamydia psittaci 02DC15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384454201|ref|YP_005666796.1|
Domain Number 1 Region: 12-158
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.24e-26
Family N-acetyl transferase, NAT 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384454201|ref|YP_005666796.1|
Sequence length 170
Comment putative acetyltransferase [Chlamydia psittaci 02DC15]
Sequence
MTENKDTGVPGLDIRYTLPSDAVYMRQWLNDPKILRGFPLKTEAEIHDSVNFWVGFYRYH
SSLTAVYEGEVAGVATLILNPYIKVSHHALVSIIVGEPYRNKGVGTALLNNLCHLAKTRF
HLEILYLEVYEENPAIALYKRFGFIEVGRQKHFYKDEIGYLAKIIMEKQL
Download sequence
Identical sequences A0A0E2J0Y7 A0A0E2JAP2 A0A2D2D865 S4MD25 S7ILC3 S7J967
gi|407460339|ref|YP_006738114.1| gi|384453223|ref|YP_005665819.1| gi|407456358|ref|YP_006734931.1| gi|407454989|ref|YP_006733880.1| gi|449070816|ref|YP_007437896.1| gi|384451273|ref|YP_005663871.1| gi|332287122|ref|YP_004422023.1| gi|392376375|ref|YP_004064153.1| gi|332287122|ref|YP_004422023.1| gi|407453658|ref|YP_006732766.1| gi|407458969|ref|YP_006737072.1| gi|384454201|ref|YP_005666796.1| WP_006342842.1.1164 WP_006342842.1.11713 WP_006342842.1.12211 WP_006342842.1.13912 WP_006342842.1.17627 WP_006342842.1.18414 WP_006342842.1.1931 WP_006342842.1.19843 WP_006342842.1.21207 WP_006342842.1.21855 WP_006342842.1.24561 WP_006342842.1.28891 WP_006342842.1.31403 WP_006342842.1.33036 WP_006342842.1.33221 WP_006342842.1.34025 WP_006342842.1.37886 WP_006342842.1.37937 WP_006342842.1.38386 WP_006342842.1.39749 WP_006342842.1.40572 WP_006342842.1.46040 WP_006342842.1.46631 WP_006342842.1.5305 WP_006342842.1.53856 WP_006342842.1.57788 WP_006342842.1.64751 WP_006342842.1.66441 WP_006342842.1.69777 WP_006342842.1.75063 WP_006342842.1.76581 WP_006342842.1.77465 WP_006342842.1.81755 WP_006342842.1.84771 WP_006342842.1.87516 WP_006342842.1.91940 WP_006342842.1.9241 WP_006342842.1.97314 WP_006342842.1.99633 gi|407457722|ref|YP_006736027.1| gi|384452249|ref|YP_005664846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]