SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSOIDT00008036001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00008036001
Domain Number 1 Region: 1039-1140
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000137
Family Single strand DNA-binding domain, SSB 0.00059
Further Details:      
 
Domain Number 2 Region: 929-1034
Classification Level Classification E-value
Superfamily BRCA2 helical domain 0.000000126
Family BRCA2 helical domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1188-1286
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0000569
Family BRCA2 tower domain 0.0043
Further Details:      
 
Weak hits

Sequence:  GSOIDT00008036001
Domain Number - Region: 1372-1448
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0234
Family Single strand DNA-binding domain, SSB 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00008036001
Sequence length 1514
Sequence
MTGKYDGLVKKYLKKTKRLKSLKVFERCLKKKEKKDRNKATKLSFAKQKAPEKKKNENSG
TMNRSDDSILTRDIEYNGSISYLDSSPRVPLLDPYDLFESNSAEIEEIKQALPKCDDSET
LLNTTSQLVNLCNDDDDSFGKVSDKINVEKEVDDSFEFSQELTSQYFMPSETQTTSQRPE
KPNVVKIDDEFDFSILKKPSKNTFKPPSTLNKTSSRLDKSAIVKQFDQSGSTSLFTTGTG
SRISLPGLTLLNKTKVSIPASVVFASPKIPLEEKKALDKKAFAADEGRKQPLVEISPNLL
ANKSPIASTNDSLENSLSQCLFNSVSPVNRPKAFAETKKEPVNKISKNIFKGLNETTTDD
VAPNKEEILQKRVFQGFKTGLGAPAKIDSAALKAFRDCNQEKSQNDQLSDAAKKSSFPGF
KTFNSHGGDVKIDNAAIKHVKNLLSTDTVSTPTFAGFQTALGNPIEIDKKTLEVFKNTLD
GSETYAKGSGFGGFQTAHRVPMKIDEKALQVVKGTLNSQLNTTESGFSGFQTGLGSKVKT
VESALKFIKDQERSHIETNATQNTTAENLNAKLDLLLSATSSTSNMITPEVQPILDLEVT
SSSLDRSLSPSIAFFEIIKKDLQLKSENLMPKTANELPEPKLSLPKPEFMINPSLKRKSD
EADAPAKKLKRSFMLEYSQEKLDIMRAQILLEKCRCSVNLPPALRRDPPELEYIEETEDK
DESTIKEAKEKESTEKRSERVEEPCRIYLPWACFFNPESDSSLTRLTLIADELELKERRS
SFFKKGNPSTSFAVPVKAPKNITKHSTPKVCLSLKHVKLPGLGLSPITENNRMNLQEEAS
KNIIEDDEFDMELDDELDNRIMSAEEIERLNLLVFKIENNISKKTRTQDRYGDRMNRKKY
HQEKGQTVRLKDLAPKLNAQTQSNAGHAGHNFNLFDHYTKEALLHGTKAPDGGIYSCAAD
GTFATKHIRRTLLSSSINSSFHPKLTVKWVENHVKLVKQKLAGYHNYLDHQLTGLIFDPD
ELLLQLRLRADVEFIDGKRSLIVKISEQDVAPTMPAVLYISSKQPLRLSDGWYEINCTGD
SLIEKRLENLSIGSKILVCGATLSKSVQAAHPLESISEINISANSTKRVKWHTQLGVFFK
NVPPSTLSSVSSAGKKIFKLKLKIVRKYPDIWIQDNPAKEKRRAIFSKRQRDRLHAQKDK
NMDLQREKLAATIKKKHREDLNEELANITLKEIAELDDPEDIYTAVTLSKDPEDTVSNLT
EDQRKKYQKFAEKQNFKINESFRREHQQNAAATSKKLRFKVEEDSRQSILQISENQLPEN
LRPGSVVIVECANVPVTCGGKITLKKHSQIRVIEQETPRAELPTDFAKILPELSATVTEV
DLAGIVVDLTPYSCVLADNKKQYVNIQLSDTWSFQALDKIVIVGAVLAFQNLEIDRKKPH
HLRLTSVSEVFSQISDFNGSHSVLFNLFNALCRVFIRTGHESAIAAYRSSANASLTTPPA
RSSSSTRSTPKCCQ
Download sequence
Identical sequences E4XD02
GSOIDT00008036001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]