SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSOIDT00012901001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00012901001
Domain Number 1 Region: 17-39
Classification Level Classification E-value
Superfamily Nucleoside hydrolase 0.00000196
Family Nucleoside hydrolase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00012901001
Sequence length 62
Sequence
MKLGKFLSSVLIRALASKRVIVDCDPGIDDALAIKYLLERIHLLFFLIFEIDKEFCFVEH
QE
Download sequence
Identical sequences E4XJU6
GSOIDT00012901001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]