SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSOIDT00012956001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00012956001
Domain Number 1 Region: 250-380
Classification Level Classification E-value
Superfamily Plus3-like 7.59e-31
Family Plus3 0.0000784
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00012956001
Sequence length 504
Sequence
MSKRRIQNLDDSSDGEDNPKVTKLVTSESHTSDSDSEWNTNGKNKRIKKEKRSKPKIEDD
SDSDSEASDAFDDGWGDDLIGDEKDREEIEAMTEMEREQVLFARGERRDAERKRWEIEKR
IKQRNREKKKDDGDDEDSQLTNSRDKSSSPEPSDPALARARNQKREKSDALGRLKEQREQ
KEKRAKEGSSKSGPLNVGDYFSSDSEEEDEEGNNLASSDSDSDDDRRRSSDDDKEDEELA
RKRKKVECKEELKPAKMSRFRLCQWMHMPWFRNTIVGTYVRVSIGLGDESGARYRIAEIK
DTGESSKTYKLDPGDPKATKIHTNKTLLLRIGNSDRAFRMCFISNSDWSDTEFDFWKKHG
LKSGLPTVGDIEKKQKELERMKKHVITDREVETMVKEKAKHRTNPINFALQKTTLLKMRD
AAETAGNIEEVASIQSKLEEIEKRANKLSRDRQAGIAGITEINERSRRKIRGMESVCEAE
WAKFRNNDKVDPFTRRTTAPILGN
Download sequence
Identical sequences E4XK07
GSOIDT00012956001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]