SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSOIDT00007801001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00007801001
Domain Number 1 Region: 41-89
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000000000000425
Family Transcriptional factor domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00007801001
Sequence length 91
Sequence
MIIRCKACPFKAPAKIYHDSMLNFSEVIINYPRNYYKKKDDGNLGQETSHLCSKCGHMFA
WLKTMQLRSADEGQTCFYRCQKCQNIDKEDG
Download sequence
Identical sequences E4XCE0
GSOIDT00007801001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]