SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSOIDT00008158001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00008158001
Domain Number 1 Region: 343-501
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000000542
Family CBS-domain pair 0.0068
Further Details:      
 
Weak hits

Sequence:  GSOIDT00008158001
Domain Number - Region: 585-641
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00404
Family cAMP-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00008158001
Sequence length 759
Sequence
MVFTWPSLLLLLLLQSASAQGGPSELYGLKLDNWKVSETNLLAYQAVEDQIAGSLPVAVN
GDSRIILFGENLIGRKFVLTTYTGNNGPKCNDHGHTKSVPVLAYAEQLDVGVADINNTAF
EDIAAGKYYFCFEDPSNGDVYNHAGNSSIQSIYFVEVDSQTSMLPVPIQTICIGLLLCLS
GTFSGLNLGLMALDPQQLKILTTSGTPDEIKFSKSVLPVRIHGNFLLCTLLLGNVLVNNT
LTILLDDLTSGTVAIIGATAGIVVFGEIIPQAICSRHGLAVGYHTLPLTYIFMAITGIIS
YPLGKLLDIVLGEEMGVNYKKQAFLELIKQGQNDLEEDEKIMIEGALKLSEKNVRDVMTP
INHVFTVCEEEIIDYDFMGRVSDAGYSRIPVTKRGGRNSDITGLLFLRDLVMLDPDDNTI
VSTVTNFYKHQLMTVDQDMKLDDMLEEFKKNHHHLSLVTMPIQTGTETDSKAERETCGII
TLEDIIEEIICDEIVDETDQYRDNRSRIRNHKHEKPENPKDFFRNHSEACDPTSNPQNPD
NLDEITRAQIAAVQRFMVAEVKPFSQDFISENKLKLLLFQQNSIVYVKRSSETKPLLTRG
QPVTQFIVIIEGKAEVQLGEDEMPIEVGPFRCFGVSALLDVKPTNLAENVTIQGSQSIPT
GLAGERDSADRSGTPSSHAGVISDATVRIISDEFIYARVTRAEYRQMRNQFEITKAQQLS
ASMEQLHSTGLSPENTTVANVNETDGSESDIKEPLLGKK
Download sequence
Identical sequences E4XDB8
GSOIDT00008158001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]