SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSOIDT00010060001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00010060001
Domain Number 1 Region: 30-203
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000000017
Family Galactose oxidase, central domain 0.03
Further Details:      
 
Domain Number 2 Region: 247-335
Classification Level Classification E-value
Superfamily Kelch motif 0.000000000759
Family Kelch motif 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00010060001
Sequence length 367
Sequence
GLGLYKNQPASVGCYYKQHQKAETLSATGWTALPNHPKRISRHSLVALDNQSLLLIGGQD
WGYGGASQSGIWQLKNENWNKIGELLQSDVFILVIPSSVDKIYLQSGDGSSQISATINAP
ENNYAYHATHALVNGKLHIFGGSSDYKKIARLDDCTLNELTVRLNEQRISGHAALSIENG
KKALICFGDSGDIRKSCEIFDDLTTVSTFASDSTHTFGGLGLYKNQPASVGCYYKQHQKA
ETLSATGWTALPNHPKRISRHSLVALDNQSLLLIGGQDWGYGGASQSGIWQLKNENWNKI
GELLQANYFGSAIYIGRSIYYFGYISKAIQRLDFTETEEFHNVAQIGSQPGNFAFPVLFQ
TVSNYCL
Download sequence
Identical sequences E4XZA1
GSOIDT00010060001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]