SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSOIDT00011015001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00011015001
Domain Number 1 Region: 306-496
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-47
Family cAMP-binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 73-303
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000192
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00011015001
Sequence length 672
Sequence
MRVNPILKDGDVEVKAQANPFLWIFGLFKLMKRNKKKKDAKGELKKSDSFLAGIGGDKTE
EKKKFKWAEFYLDPSGDLYYYWVCVIAASVMYNLLFIICRLAFDQLVDYKMLFLGVDIFN
DFVYSIDIFGKFYTGYLDKGLMITDHKCIREHYKTSGRFKTDMMSMCPIDYLQYCFDNKW
LVSLRFIKCQRKYRVSEFINKTETRTNFPNFFRISIMCTSILVIIHWIAGSFPMSPLLAM
NLLSWEGGISTQCTGRRSPWPRSEKLQNPETNFEYIFQISNFLIGIFIFATIVGEVGTMI
SNMKATKTEFQGRMDALKQYMELRSVDSDLQSKIVNWFDYLWGSKKGVDEVGVLSHLPDK
LRAEIAINVHLDTLRRVALFRDCEKGFLVELVLRLKPQIFSPGDYICRKGDIGKEMYIIL
QGDLEVVADDGKTRFCVLSSGKYFGEISIMEIPGSKAGNRRTANVRSIGFSDLFCLAKED
LTEVLVEYPDAKKILEEKGRDMLMKDNLIDLNWIDEATRHQQFMDSLKGDVELIKNQMSL
LMQNFDMISKERSQQRRRLKAHPIVYEDPEEEPLTTILKEMNQNAVDNETEKDGVKLINK
SNEEDVFSDASSSDNESVLSNSSTIPTLPPTPTPPEEKAPVKRLSLNTNNSHSILDNDSE
SDDGAEEAFCSV
Download sequence
Identical sequences E4XHN4
GSOIDT00011015001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]