SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSOIDT00012320001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00012320001
Domain Number 1 Region: 96-152
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000817
Family VPS37 C-terminal domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00012320001
Sequence length 240
Sequence
MDFTSILQGKNREELEKLSSNEDEINEIVLNSEPIQHLFMEKDLILAANRQMAEGNLALK
PRLEESRNALIEMHNKLASKQDQLQSKQRELESKRSSYSPDSAAAILQASAAEAEQNSEV
IADGFVRGEIDVKDFLKEFLDSRSKSYDLKHKAENMVKVFQSSQNRAQSQQRPIAPSPYP
SRAPAGAPYGNPYVPTPAQPSAAVPYPSVPYGAPHQPARQAMPYPPSGGAFPAYPPGSAF
Download sequence
Identical sequences E4Y0J6
GSOIDT00012320001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]