SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSOIDT00016939001 from Oikopleura dioica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSOIDT00016939001
Domain Number 1 Region: 145-205,436-618
Classification Level Classification E-value
Superfamily Kelch motif 1.19e-16
Family Kelch motif 0.018
Further Details:      
 
Domain Number 2 Region: 49-234
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00000000275
Family Galactose oxidase, central domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSOIDT00016939001
Sequence length 652
Sequence
MLFLCPCIEQESDVFILVIPNYVGESYLQSGDGSSQISATIDAPENYYASEAAYALVNGK
LHIFGGNSDGTKIARLDDCTLNELTVRLNEEREVGHTALSIENGKKALICFGWTDEIRKT
CEIFDGSTTVSTFAADSTHYSGGLGLYKNQPTSVGCYDAKHRKAETLSATGWISLPDHPK
RISSHSLVALENQSMLLIGGIDFGNGNAFQSGIWQLKDENWNEIGELLQSFENSSRIFLT
ARFWNIFVIQEMRFLLIILINLAQASLRQRETCNDQEINNECLAVCDAEYFDCSKNCVNS
DCLRKCAEEVIACENSCPCGADCPTGCVDCPEHPLCADECEDAQFINNEYKICVNAAIYE
LDFCLKTCPPEIGCHNSCYENYSQMLFLCPCIEQETTTTTQISPIEPSDVFILVLPNKVD
ESYLQSGDGSSQISATINAPENRYARNAAYALVNGKLHIFGGYYDWTKIARLDDCTLNEL
TVRLNEERYVGHAALSMENGKKVLICFGWLDPASVGCYFEQHQKAETLSATGWTALPGHP
TRISRHSLVALDNQSMLLIGGKDNGNDGVSQSGIWQLKDENWNKIGELLQADYRGSAIYI
GRSIYYFGNVSNAIERLDFNEEEELQKVAQIGNQPSQYYLPVLFQTVPNYCI
Download sequence
Identical sequences E4XPH3
GSOIDT00016939001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]