SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384453275|ref|YP_005665871.1| from Chlamydia psittaci C19/98

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384453275|ref|YP_005665871.1|
Domain Number 1 Region: 11-307
Classification Level Classification E-value
Superfamily SIS domain 8.45e-51
Family double-SIS domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384453275|ref|YP_005665871.1|
Sequence length 329
Comment carbohydrate isomerase [Chlamydia psittaci C19/98]
Sequence
MSSPTTSIDLCQDIVSKQRESLERFFDSFQCEDTWVLAEKILNHQGSIFFSGVGKSGCIA
RKIVATLQSFGERALFLASGDLLHGDLGVVRPGDIVCLFSKSGETRELLECIPYLKERGV
FIAGITSATYSSLAVLCDHVVILPMIEELDPFNLVPTTSTTCQLLFGDLLAITLLRSRQI
SLADYGKNHPGGQIGLKVIGKIRDYMFPKTEVPFCSPEDTIADSLDIFSSYGCGCVCIVN
EKFEILGIFTDGDLRRSLTRHGGDILSQRLKDVMTPNPRVISEDADVLLGLQMMETGSPV
TILPVVDAKDQKYVVGLLQMHTLAKAGLI
Download sequence
Identical sequences A0A0E2JAT8 A0A0E2JDV6 A0A2D2D8A7
gi|384451325|ref|YP_005663923.1| WP_006342897.1.11713 WP_006342897.1.12211 WP_006342897.1.13912 WP_006342897.1.17627 WP_006342897.1.18414 WP_006342897.1.1931 WP_006342897.1.19843 WP_006342897.1.21207 WP_006342897.1.24561 WP_006342897.1.28891 WP_006342897.1.31403 WP_006342897.1.33036 WP_006342897.1.37886 WP_006342897.1.37937 WP_006342897.1.38386 WP_006342897.1.39749 WP_006342897.1.40572 WP_006342897.1.46040 WP_006342897.1.46631 WP_006342897.1.5305 WP_006342897.1.53856 WP_006342897.1.57788 WP_006342897.1.64751 WP_006342897.1.69777 WP_006342897.1.75063 WP_006342897.1.76581 WP_006342897.1.77465 WP_006342897.1.84771 WP_006342897.1.87516 WP_006342897.1.91940 WP_006342897.1.97314 WP_006342897.1.99633 gi|407453715|ref|YP_006732823.1| gi|392376425|ref|YP_004064203.1| gi|384454253|ref|YP_005666848.1| gi|384453275|ref|YP_005665871.1| gi|332287172|ref|YP_004422073.1| gi|332287172|ref|YP_004422073.1| gi|384452301|ref|YP_005664898.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]