SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479170119|ref|YP_007798444.1| from [Eubacterium] cylindroides [Eubacterium] cylindroides T2-87

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479170119|ref|YP_007798444.1|
Domain Number 1 Region: 51-287
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000664
Family Phosphate binding protein-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479170119|ref|YP_007798444.1|
Sequence length 297
Comment hypothetical protein [[Eubacterium] cylindroides T2-87]
Sequence
MSVRKIISLALSLVLSVSLVACSSSNEPQEPIKVLSPTGAPALSLLSLYENENVEIETVE
GTDVLTAELSKKDSEYDIIVAPTNLGTKLYSQAEAFNLEAVLTWGNLYLVGPEGSDLTSA
SIAAFGEKAVPQLVFQYVMDTANMNVTYYASVQEAQQALLTGQSEVALLAQPVAAATIAK
AKEQGKELSVLEDLQALWKEKTGSDEDGYPQASLFVRADANVDYALDLLQDTELSEDEMK
EIIDKVGVDKLGVPNAEIAVNTYSKQNIRYEAASDVKDQIEEFLNLFNIELPEGLIK
Download sequence
Identical sequences D4JF66
WP_015536054.1.9409 gi|479170119|ref|YP_007798444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]