SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479170358|ref|YP_007798683.1| from [Eubacterium] cylindroides [Eubacterium] cylindroides T2-87

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479170358|ref|YP_007798683.1|
Domain Number 1 Region: 37-324
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.71e-61
Family Phosphate binding protein-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479170358|ref|YP_007798683.1|
Sequence length 337
Comment ABC-type Fe3+ transport system, periplasmic component [[Eubacterium] cylindroides T2-87]
Sequence
MKKLGVLAMAGMMALATGCQAQTSTLTEDTTSLSGSLTVYTSQPEEDIQALVEGFNEIYP
DVTVDIFRSGTEEVVSKVLAEKEVGSVLADVLLVSDATTFEALKAEDILESYESPELEGI
SEEYYDTDHTYTGTKILTTGVVYNTDLVDGEVKGFADLTGEAAKDNVVMPSPLYSGAASY
NLSVLTQTDGFGWDFYQALKDNNVAVEQGNGTVLQSVTDGTKAYGMIVDYMALRAKADGA
KVEFVYPEEGSLVITEPIGMVKDCANSDQAKAFIDYILSEEGQTKTAEIGYTPIKEGVEA
PEGFKKADEINAISVDIKKVVETKEADKEQFATMFGA
Download sequence
Identical sequences D4JFV5
WP_015536293.1.9409 gi|479170358|ref|YP_007798683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]