SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AGAP004730-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004730-PA|hypothetical
Domain Number 1 Region: 15-151
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.66e-17
Family Insect phospholipase A2 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AGAP004730-PA|hypothetical
Sequence length 188
Comment protein|protein_coding|2L:2865994-2866766:1|gene:AGAP004730
Sequence
YGSALQPLHGGLKFFTYYCGPGNWSADGSTVQNAYFSSIDQCCKHHDECPDTIVHSRDYH
RYEDLPYKAQIFTRLRCNCDVEFLRCLQNISTFFSYAVAWIYTKFQSSCFDYEYPVMECT
VKRNDGLFTADRCLAYMVDNSYSKRWQWFDIPYIGSNQLIFPEVEYRYDLNWFNILFERN
ITPNVSIS
Download sequence
Identical sequences A0NFH9
XP_001231097.2.40869 7165.AGAP004730-PA AGAP004730-PA|hypothetical AGAP004730-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]