SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AGAP004731-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP004731-PA|hypothetical
Domain Number 1 Region: 105-236
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.71e-34
Family Insect phospholipase A2 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AGAP004731-PA|hypothetical
Sequence length 243
Comment protein|protein_coding|2L:2867613-2884739:-1|gene:AGAP004731
Sequence
MHQLTMGRFVVLCWWFLLLTNTIYRTQVACSSVLVADFRMTRMVELSSRPPYCKIHSDRG
DIQRMLLASDTKKVRQVPRESVIALEEVCGEASNISGELQGGLGFIYPGTKWCGPGTIAT
NYSDVGRYAAEDQCCREHDLCPNVLLPGECRRGLCNRGAFTRSHCDCDARFRRCLQNLNT
ETANTLGAIFFNVVQVTCFGERRPCSVWQRVGFNQTEADELCSRWKYRPSEKYIPIMQQK
SNK
Download sequence
Identical sequences Q7PMV3
AGAP004731-PA AGAP004731-PA|hypothetical 7165.AGAP004731-PA XP_318096.4.40869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]