SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AGAP010879-PA|hypothetical from Anopheles gambiae VectorBase AgamP3.6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP010879-PA|hypothetical
Domain Number 1 Region: 56-188
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.62e-32
Family Insect phospholipase A2 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AGAP010879-PA|hypothetical
Sequence length 197
Comment protein|protein_coding|3L:12385973-12386753:-1|gene:AGAP010879
Sequence
AVLPLLCVASLGVRTVCSKLLYKNVETFDFGNELENRDGEQGKSGANRTQERINLTVPGT
KWCGPGNTASDYEDLGSNSEVDKCCRDHDHCDNIPAGESKYGLKNNDYFTRLHCKCDRDF
QNCLRRVNTTFSNKLGNFYFTVRDQCYKKQHPIVDCAEHTNKIFLRRCVRYVLDTSRSDM
WQWFDLPFYDDNVLDGF
Download sequence
Identical sequences Q7QGS9
7165.AGAP010879-PA XP_309822.4.40869 AGAP010879-PA|hypothetical AGAP010879-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]