SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene11257 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene11257
Domain Number 1 Region: 61-258,379-426
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.65e-55
Family Tandem AAA-ATPase domain 0.00000157
Further Details:      
 
Domain Number 2 Region: 428-536,632-700
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.22e-38
Family Tandem AAA-ATPase domain 0.000069
Further Details:      
 
Domain Number 3 Region: 733-856,927-992
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.44e-36
Family Helical scaffold and wing domains of SecA 0.00082
Further Details:      
 
Domain Number 4 Region: 257-378
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 4.19e-35
Family Pre-protein crosslinking domain of SecA 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene11257
Sequence length 1020
Sequence
MASTSLQIPTFLSLKPLPPRATFAFPTSFSSFPASSPPPRRRLTLSSASLKENLGRLGKT
WNDVTSLNSWVVHDYYRLVSSVNSFEPQLQRLTDDQLTAKTAEFRRRLRQGETLADIQAA
AKRKLGMRHFDVQIIGGAVLHDGSIAEMKTGEGKTLVSTLAAYLNALTGEGVHVVTVNDY
LAQRDAEWMGRVHRFLGLSVGLIQELGFDYLRDNLAGNSGEVLFPVSIRPKPFHFAIVDE
VDSVLIDEGRNPLLISGEASKDAARYPVAAKVAELLVRGIHYTVELKDYAVELTEEGIAL
AEMALETNDLWDENDPWARFVMNALKAKEFYRKDVQYIVRNGKALIINELTGRVEDKRRW
SEGIHQAVEGKEGLKIQADSVVIAQITYQSLFKLYPKLSGMTGTAKTEEKEFLKMFQTPV
IEVPTNLPNIRNDLPVQAFATAQGKWEYVRQEVEYMFRQGRPVLVGTTSVEHSEHLSDLL
REHNIPHNVLNARPKYAAKEAEIVAQAGRKHAITLSTNMAGRGTDIILGGNPKMLAKEII
EDSLISSLTREAPDIDIDGEAISQKVLSKIKVGPSSIALLAKTALMAKYVGKNEGKSWTY
KEAKAMISESVEMSQSKDMKELEKLVDEQSEMYPLGPTIALAYLSVLKDCEVHCFKEGSE
VKRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRFMDEMFQKFNFDTEWAVRLISK
ITDDEDVPIEGDAIVRQLLSLQINAEKYFFGIRKSLVEFDEVLEVQRKHVYELRQSILTG
DNESCAQLVFQYMQAVADEIVFKNVDALKHPRNWSLNKLLTEYVEIAGKLLDEITEEALL
KSLAQSPELNYKEIDDIHLPNLPRPPNAFRGIRKKNSSLKRWLAICSDDLTKNGRYHATT
NLLRKYLGDYLIASYLDVVQDSGYDDTYVKEVERAVIVKTLDCFWRDHLVNMNRLSSAVN
VRSFGHRNPLEEYKIDGCRFFISMLSATRRLTDWTQQLHRFTDEGMCLLMNIGIGTAITP
Download sequence
Identical sequences gene11257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]