SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene12352 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene12352
Domain Number 1 Region: 524-691
Classification Level Classification E-value
Superfamily BRCA2 helical domain 2.35e-38
Family BRCA2 helical domain 0.00093
Further Details:      
 
Domain Number 2 Region: 692-816
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.4e-37
Family Single strand DNA-binding domain, SSB 0.00012
Further Details:      
 
Domain Number 3 Region: 820-849,967-1048
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-20
Family Single strand DNA-binding domain, SSB 0.0084
Further Details:      
 
Domain Number 4 Region: 850-967
Classification Level Classification E-value
Superfamily BRCA2 tower domain 9.81e-19
Family BRCA2 tower domain 0.0024
Further Details:      
 
Domain Number 5 Region: 1054-1186
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000134
Family Single strand DNA-binding domain, SSB 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene12352
Sequence length 1361
Sequence
MFSDAADNFRWRFSAPDPNTRPPDAAFYTGNENLSSSARLPSMADLLLQGCSKLAAESQM
SHGGLGRSVSVKPSSLAKAASLLGASDSGRMRGSGGEIRGDGFGDSLFQTASGKMVNISS
KGLVKAKKLLSLEDENEDCSLFSGFNIGGVKDAASVSRSSVNHMTGSVQSGLTDVSNLSS
VQAQVPSLACTPSSVKLHTPGGRSTSVSTDGCMAGSMQSRCKNEFDQRFMQSEMTNSVST
PSSVQLPTPSSIDAHKTGLVQSRFKNESKLNHLQSKMPSSASTPSSSKLLAAGGSSECLS
TDPHKTGSVQSGVTNVTDLSVMRFQKPNIAPKPSSIKFSTAGGRSISVSTDALQRARNLL
GDPDLGTLLDEGNSDMDLTFSKGCEHDSHTASSHQKKPKSKFLTKSFVSPLQSSTNQVQT
SAVKSDSTNWGTNLISQFDVVSNENARRSNGELPCGKKPFSNKPCTLTTAENNYLANGNG
ERIDPVERSLAKPLVDISNTIGTSPLSNIRMAGVKRKLGGNSVSSFKKPRISNFSTPLHR
NVPLVPNGLSTFPSDHSSFKGRVSTRYPVLVARMPLKKYFGMPPSDQTMVDCMSDQVRRV
TAINAENYMFPDESGLNYVGAEAVMHILASSGASTKNTFREWVINHYKWIVWKLSCYERC
YPTKALGKFLTLPNVLEELKYRYEREVNHGHRSAIKKILEGDASPSSMLVLCISAIRTKH
GPNIETSSGAENSSAAKVELTDGWYSVDAILDALLSKQLASGKLFVGLKLRIWGAGLCGW
VGPISPLEVSREVMLRLHINGTYRAHWDDRLGFCNRVGPPLAFKCIKSDGGLIPWTLVGV
TRIYPVLYKERLSNGRSVVRSERLETKMMQSYSQRRSNVIEGIISEFQRGLEHSHTCNER
DSEGAKLLRILETAAEPEVLMAEMSTEQLNSFTKYRAKLEAIKQSDMEKSITKALEDAGL
AEREVMPLMRVRVVGLTRSLCKGKDSPKEGLITIWNPSEQQKSELVEGQAYTVSDLIPTS
PAADILYLLGRGSKTKWKPLCQQTMDNFSPRKSMLLSDFGQVPLSSEFDIAAFVLFVGDV
YIAGHQKKQWVFVTDGSISESKSEGLNDSLLAICFCSPHVDDQSDPPLNYNLAGSTVGFC
NLIKRAKDQMNALWVAEATENSAYFLSFDSRHCSHLKDAAASAERWGRISSLLRGKGSLA
IYHLLPGNHVNDASSPFSSRFSSSIQLREASTAKKQKHAWPEFKLSNAIDYSLMSDDHRY
AGSYDFPRERIIYVPWIAKYQMHQKKEERLLRDPEEEYEHTLIIQNLSRKWFLYQDVVNP
PETIIEKLHELPKTYCTTSFKEDHPIKDGEHESRTSSVKSL
Download sequence
Identical sequences gene12352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]