SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene14779 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gene14779
Domain Number - Region: 27-85
Classification Level Classification E-value
Superfamily TSP9-like 0.0889
Family TSP9-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gene14779
Sequence length 128
Sequence
MQKMITAISSVIRTQTPSYLGRKASQVGFIRQARTIVSSDPGSKHNMDKAENPNQKTATG
DVMSHSFGEGYATRSDEEGFGGIYSDNQRLPNKVEQDQMIHANNPAYDKTQGSEVKEKEK
ARHQPKAN
Download sequence
Identical sequences gene14779 XP_004287902.2.20112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]