SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene15998 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene15998
Domain Number 1 Region: 356-505
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.7e-26
Family N-terminal domain of MutM-like DNA repair proteins 0.0014
Further Details:      
 
Domain Number 2 Region: 500-587
Classification Level Classification E-value
Superfamily S13-like H2TH domain 6.8e-24
Family Middle domain of MutM-like DNA repair proteins 0.003
Further Details:      
 
Domain Number 3 Region: 13-77
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000167
Family B3 DNA binding domain 0.0089
Further Details:      
 
Weak hits

Sequence:  gene15998
Domain Number - Region: 118-153
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.053
Family B3 DNA binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene15998
Sequence length 813
Sequence
MGSLRRHHTFSSITPQFFQIILDDTSRDIKVRIPKKFVMKYGQDVSNSACLKLPSGAEWE
VELTTCNDKVWFEKGWPENATEIDHPITKMLGMEEMDHEDEEDGDISTEILEDSPPRRPS
FPAEFLKKNQIKDAANVILRVSNGKTWTLIFYFKLNFSELQAASRGRCFQNLQLCFQFSR
VAGHGRGAATQVGNNITSIKVEPDCSMNGGITGMASINPSPLDIGGRNKRSETSGEAAKR
RCSSLRVPSVNNVEAANKFFPNNPFFKVSLRAYNIERANVRLIAFAREHDLKKVIASKSN
SNPTAPIPHLPLYPHTSYLSHSPGLYKSPQNPKNPRESTERERERPKCTQKAREMPELPE
VEAARRAIQDNCVGKKITKAIVADDSKVIDGVSRADFEASLLGKTIISAHRKGKNMWLQL
DSPPFPSFQFGMAGAVYIKGVAVTKYKRSAVKDTDEWPSKYSKVFVQLDDGLEFSFTDKR
RFAKVRLLKDPTSVPPISELGPDALLEPMTVDVLFASLSKKKISIKALLLDQSFISGIGN
WVADEVLYQARIHPEQSSATLSKECVEALHKSIKEVIEKSVEVGADSDQFPSNWIFHSRE
KKPGNVLVDGKKIDFITVGGRTSAFVPELQKLTGNQAANAESKRTSKRVDDVDEEASDKE
VKGTAKSRKGRKPGGQAKRSTVKRKSKGSDEDNDNDDSTDDVDHDDNDDSADEDMKNRTR
KFVAQSCVSEGKWVQDGIQDSVFRIHKMLGIAPLEMIAIPYLTTLTTSYGLLFAFEQDAA
EVEKALWIWVVWRRRSKRIKEEEEEEEEEAMRN
Download sequence
Identical sequences gene15998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]