SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene18766 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene18766
Domain Number 1 Region: 102-219
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 2.22e-16
Family N-utilization substance G protein NusG, N-terminal domain 0.0031
Further Details:      
 
Domain Number 2 Region: 274-325
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000572
Family N-utilization substance G protein NusG, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gene18766
Sequence length 330
Sequence
MTQGLLQWSPCHHSLSLLPISIPTSKHTHLPLSISASLESSTQQQPQLSARERRQLRNER
RERKAGTSWKEKVEEKLLEKPTQKFAHWKEELNINNLAREGPQWWIVRVSRIKGQETAQL
IARLLARNYPHMDFKVYAPSIPERRKLKNGTYSVKAKPLFPGCVFLRCVLDKEIHDFVTE
LDGVGGFIGAKVGNTKRQINRPRPVSEFDMEAIFAKAKEEQEKSDLAFQQEQQLSSELKS
SDAAKSAGDAKPKRRSGKASDPLINGSSTAKDKKLVLGSKVRVLSGTFAEYEGSLKKLNR
RTKKATVAFMLFGKESLVDLDVSEIVSETL
Download sequence
Identical sequences gene18766 XP_004302675.1.20112 XP_011466507.1.20112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]