SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene19042 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gene19042
Domain Number - Region: 17-54
Classification Level Classification E-value
Superfamily TSP9-like 0.051
Family TSP9-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene19042
Sequence length 78
Sequence
MSKKNDLGRRKRQHEFELRREKEEKEKRAKKLQAKKNKMKVDGTEKKKGGFHVGKKKLKT
KMTALAKAKAAQAMEVDK
Download sequence
Identical sequences gene19042 XP_011469030.1.20112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]