SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene07345 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene07345
Domain Number 1 Region: 119-213
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-20
Family B3 DNA binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 694-791
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.69e-18
Family B3 DNA binding domain 0.0028
Further Details:      
 
Domain Number 3 Region: 505-605
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-18
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 4 Region: 349-431
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000194
Family B3 DNA binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gene07345
Sequence length 797
Sequence
MVYSTTIELATQPSSYPFARFSFDHTYHTSLRPIAIASVVPQPDEERRSEANDGGGRRGR
GERESKKLYWVMCSPNSWQGLQNPRNFGYLISLRLKSIPTTAMESKTHRRSDVPARVPFH
FFRIILQPDQQRQKLNLPTKFVKKFRKELSDVATMSIPTGHVWPVGLERVNKRVWLVENW
QAFAEYYSLRYGDFLEFRYERNSNFHVSIFDRTCTEISYPCQEQSSDLHPVVLHQEDIRN
DDVSDTLDAIPSLSHASRSVKGKRKCVDERVVEKRHVLHSGSSNKCIQRGATSKENMGYQ
SDDATRRKKTIYVDQGDTIDSSIVTKSAPASLKKNRMASSLELTKQNDDQKHMPTEFAEK
YLSGCSEVIKLQGSHGKQWDVRFASTNPSLPITCRGCIKFLTDNNLAEGDVCLFELMKSK
VDMVLKVSILRAAEYEDTIHSSNVKKSKRANLDKSIMHDTEDFSTRQSEDDGKFAFDIFS
HTYPKSKLKFPTETEKVIYATRMFKLKNPFFVVILQYNNYHLCIPVDFARKYFSSCAESI
KLHDSNGGHWDVQRTYTNASSSGHRFSNGYNVFLRDKKLEQGDVCLFELIKRNDVLLKVS
VLRASEYDDRGHDKEMKVNETKNRRYRNEDEEDLPDLVGRLDDKGKSTAHKLSIEDEENI
EICSSGTLYYSSKIEKLVMSKESRRAFSDAKKFHTENAAFLVMLRHYHKSYVVVPARFDT
KHLGDECPVLITLEAPNGKQCHVRCIYDTDRKKLSDGWSAFSSENNLEEGDVCVFELIAS
KDVVLKASIFRAAEYAD
Download sequence
Identical sequences gene07345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]