SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene09230 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene09230
Domain Number 1 Region: 18-370,408-608
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.84e-91
Family Acetyl-CoA synthetase-like 0.0000186
Further Details:      
 
Domain Number 2 Region: 771-1070
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.04e-25
Family Quinoprotein alcohol dehydrogenase-like 0.007
Further Details:      
 
Domain Number 3 Region: 607-658
Classification Level Classification E-value
Superfamily ACP-like 0.0000135
Family Peptidyl carrier domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gene09230
Sequence length 1074
Sequence
MTSHADSSVQHKNTTPIQRCISHRFSTIASQNPNKIAVIHAAAESRRTRTSVAADASSSV
QAVYGGDRSFKYSDLISAVDSLTSQLRHFKLDSPSSELRPRIFGVYMAPSVEYIVSALSV
LRCGEAFLPLDPSWPKQRLLSVVASADVDLIITSTTPFGYELESSWLEKTSNRRFLWFSM
GGGESVTVTDGGEYEKEKEKERLFCYVMYTSGSTGKPKGVCGTEQGLWNRFRWMEELYPL
KGEEVLLFKTAVSFVDHLQEFLSAILTGCTLVIPPFNQLKQNVFSILDFLQAYSISRLTA
VPSLMRVILPALQGRDYQQLLSSLNLLVLSGEVLPLSLWDMLSKRLPRTSILNLYGSTEL
KWLLKSELFLWHFNAVVNLSVADMTIVKFKVSGDCTYFDCKRLPMILETETLTSVPIGIP
IAGCDVVIVSDDDVLDEGEIFVAGLCNSSGYYSDSTFTPLDTVKLPPSSLCDSSVNGHES
RSYFQTGDFAKQLHSGDLVFLGRKDRTIKHNGQRIALEEIEHILVGHPDVTDAAVVFHHG
QGELMQLVAFIILKEGQSDETFRSSIKSWMVDKLPLAMIPGRIVIMKSFPVSTSGKVDYT
LLADSAFNHVLMAEEVSDDDDFFMIGGNSIAAAHLANNIGVDMRLIYSFPTPSKLCMALL
ERKGPFSMKVKVDSESVINQGGGKNMFPVYDTPTDVNFEQLKAQSKRLKVNSSITLQSAS
PADGYPWSSVQNFMSCSFTRCNKVVYESFRVNEVYEAAGSVVVSKNRKVLLEELWKVDMG
SCVDASPLIVCKDQDIYLFIGSHSQKFACVNARSGSIQWELQLEGRVECSAAILGNFTQV
VVGCYKGKIYFLDSSNGNICWTFQTSGELPCGGSICGSPAIDEMNNILYVATTGGQMTAI
SIMALPFSIMWVHELEVPVFGSLAINSLNGNIICCLVDGHVLAFNTSGSIIWRFRTAGPV
FAGACISSGLPFQETGGLLWEYNVKDPITSSAYVDEHLSLVSDQSKFPDSSSGSIIVIQV
NLDATKGASAKNFDVEEFARLELTGDVFSSPVMIGGRIFVGCRDDYVRCIAFKP
Download sequence
Identical sequences gene09230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]