SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene12668 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene12668
Domain Number 1 Region: 265-368
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.63e-17
Family Ankyrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 39-181
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000518
Family BTB/POZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gene12668
Sequence length 585
Sequence
MEYTKGCVSDSNEVVSSSISTLAHHHSPSSSSPPPDITSLKHLSNNLELMVNSSDFDFFA
DAKIVVSNGREIHVHRCILAARSSFFRNVFSAKEGSSSTRFELKNLAKEYDVGLDSLLAV
LGYLYSGKLKSLPKGVCVCVDDACSHVACRPVVDFMVEVLYASSTFQISELVTLYQKCLL
DILEKTAIDDVLVVLHVANMCGKACEGLVRRCIEMIVKSDVDIVTLEKALPQQSVKRITD
SRLALGLDSSRSSNSPSNFPDKHTRRIHRALDSDDVELVRMLLKEGHTNLDEAYALHYAV
AYCDAKTTYELLDLGIADVNCRNLRGYTVLHLAAARKEPKIIVSLLTKGARPSDLTLDGR
KALQITKRLTRAADFFKSNDEGKACPNDRLCIEILEQAERRDPLLGEASLSLAMAGDDLR
MKLLYLENRVGLARYLFPMEAKVVLGITQLDETPAFPVACLIRNNPTGSRTTTVDLNEAP
FKIKEEHLARLRALCQSVELGKRFFPRCSEVLNKIMDGDDMSQLMYTGDDTPEVRLTKRK
RYMEIQEVLSKAFDEDKQDIDRSGMSSSSSSTSVRAVRPKLTVID
Download sequence
Identical sequences gene12668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]