SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gene13990 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene13990
Domain Number 1 Region: 14-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.43e-18
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 146-252
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.51e-16
Family B3 DNA binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gene13990
Sequence length 253
Sequence
MASSKRRKGNSLAIQEKTPGFFKVVLNKALQDGKLEIKGFVASKYRDFLANSVILKDPNG
AKWPVKLTRSDGSTWLEKGWLKFAHFYSLEEGYFLFFSYECVDSCFHVRIFSKNYIEINY
PFKSSQHEEPNLGGGDGVKFSSADSFKSTFPFCVIKVQPTYVKYYHLQIPISYAKNFICR
GQTRNVDLRIPKGKTWSAKSSVTKQAGRSEIARIHGGWSKFAKDNQLRVGDDIVLEMIKQ
QPKTTFEVHIFRA
Download sequence
Identical sequences XP_004295953.1.20112 XP_011461290.1.20112 XP_011461291.1.20112 gene13990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]