SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene15023 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene15023
Domain Number 1 Region: 436-532
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-22
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 566-662
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000373
Family B3 DNA binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gene15023
Sequence length 682
Sequence
MQSCRNLPKPTLSPQSTTSWHRSLQTKKVPSCFTSSTSMLYNSRPSRPSLSIKDEPVLLK
AGEFVCEDNNLANTALDSLGITVDSIEKPPLSDNQSLFEGEGKSAYQKHTLIERLGLLLY
SMEVEEVKHEGTFLVWRDLYHDVVDWGLKVGFGKFLQLCMLAHHGYLHTLLSPCSIFPFK
RFHLKEENSKENHTPMHKPSHAKLRYDMFIAWHNSVHAKYQKRKQIGEISYLELSKPWRL
EKPLPNESVLSKTDARARPSELLQQRKKREEEKEKSTTALAFEPSRSPHYKLLVFWFAGH
DPSEFNLDIYSSRLKVGDLSISDADPDNCFLSLDPYYEYTYIRGVYCNGAVHWESHCGSH
LHLIDICSSRIKVLEMKSDYSGFCYFVSSFLVESFGPRSPSAAAASAFRVFPGDPIDYCL
SLSSLTQVQMAASKEAFFQVLIGDFCRHLKMPTAFVDKLRGTPPFKCVLRDPDGQSWNVT
LKERAGGLFFCTGWPKFVKHHCLDEGDFLVLYYTGKHKFDVKIYDESACEMDLEVSKRRR
LTDGSSDQVMSGKAVIEETPSGLTVFKSKYSCFMKTLVKCKLYEMTIPRRIVIAEGLEKG
KPVKLQDPKKRSQIVNTNVTKDGRFKLTKGWSQSCREFEISIGDNIVFEFVKPNVILVHN
LRGKVVILEGPKVVDSSNYKKL
Download sequence
Identical sequences gene15023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]