SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene17107 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene17107
Domain Number 1 Region: 527-627
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-19
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 2 Region: 699-795
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-16
Family B3 DNA binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gene17107
Sequence length 810
Sequence
MPENTASSDTNAAVPLLESGVDGGEGLRWWNKVLDVEEAKNQVLFSLPMILTNVFYYLIT
LVSVMFAGHLGELELAGATLANSWAVVTGFAFMVGLSGALETLCGQGFGAKSYRMLGIYL
QASSIISFLFSIIISAVWFYTEPILILLQQDPQISMSAAVYIKYLIPGLFAYGFLNNILR
FLQTQSVVMPLVFLSAIPLVFHIGIAYGLVHWTALGFKGAPLAASISLCISFLMLATYVV
CAKKFEHTWEGFSLESFHYVLTDLKLALPSAAMVCLEYWAFEILVLLAGLMPNSEQTTSL
IAMCVNTETIAYMLTYGLSAAASTRVSNELGEGNPDRAKNAMAVTLKLSVLLGVLVVLAL
ALGHNIWAGFFSDSTTIIKQFAYMTPFLAISIMLDSVQGVLSGVARGCGWQHLAVYVNLG
TFYLIGVTIACLLAFKLKLYAKVFVVPSAAALVLKALMELEGDRKKVKNIMLNGAIEIAK
IDEDVRSAGVLLKNPDSSAKTISMKTQILESLISGAKLKAEMGRKPTKQPSFFKVLLDDF
ANHLRIPHKFTRYHIRPSLGKCVLRGPCGKRSVELERRKNGLFFHSHGWHSFVKDHLLQF
GDFLVFQYDGKSKFKVKVYDRTCCEIDVEVPKRRNGLPTAPSVNEGYQLAWVKDEILDGL
ETENCNSDTENADKRRRNNYGRTPKVEDGKETSTRPIIFKSEYSCFQATLKGRCSRYRMA
IPKDLVVSKGLKSKNTVEIEDSTGRLWPAKLVKGNYVSMSTGWGECSKANNIVVGDTVVF
EFVQQTVMRLHVFKKGLGTRGGNNVYFCGT
Download sequence
Identical sequences gene17107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]