SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gene20070 from Fragaria vesca

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gene20070
Domain Number 1 Region: 270-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-16
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 48-188
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000785
Family BTB/POZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gene20070
Sequence length 587
Sequence
MANSGEPSSSLSFTSSSHLSNGSISHNLSSSEALPSLEVISLTKLSSSLEQLLLDSGCDY
SDAEIIVEGDPVGVHRCILASRSKFFCELFKKEKGYSEKEGKLGKPKYKMKDLLPYGDVG
YEAFLVYLNYVYTGKLKPSPIEVSTCVHNVCAHDSCRPAINFAVELMYASSIFQMPDLVS
VFQRRLLNFVGKAMAEDVIPILVVGFHCHLSELVTHSIERVARSDLDSICIDKELPYEVA
EKIKLLRRDSQHASELSTPPVDPLREKRIRSIHKALDSDDVELVKLLLSESNITLDEAHA
LHYAAAYCDPKVVTEVLGLGMADVNLRNPRGYTVLHIAVMRREPSIIVLLLSKGARASEL
TSDGQSAVSICRRLTRAKDYHSKTVQGQETNKDRICIDVLEREMRKNPMAGDASVSSQTI
ADDLHMKLLYLENRVAFARLFFPSEAKLAMVVAQSDTTSEFAGISPSKGSSGNLMEVDLN
ETPTVQKKRLHSRLESLMKTVNMGRCYFPHCSEVLDKFMEDDLPDLFFLETGTPDEQKIK
RMRFMELKDEVQKAFSKDKAELNLSGLTSSSSSSSPKKVGVNHKTRK
Download sequence
Identical sequences XP_004293734.1.20112 XP_011460459.1.20112 gene20070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]